LD03241.complete Sequence
1248 bp (1248 high quality bases) assembled on 2003-01-13
GenBank Submission: BT003591
> LD03241.complete
TTCATACATGCACACAAGTAAAGCATCGAAATGCTGTTGAATTAATTTGT
TTTTTGTTTAGTTTACTTTCAAACCTCGCCGATCGTACTTAATTAGCACC
TTATATTTGCGACGTGTCGAATTGCCTAACTTATTTTGTTACTCTTTTGC
TTGCCTGTTTTTCCGTGCACCATGGCAGACGTACTTAAATCCGCAGGAGA
AATCGCTAGCCAAAAATCATGTCTGTGTGGACCACGGCCAACAATTCGGG
CCTAGAGACGCCAACAAAGTCGCCGATCACGTCGTCGGTTCCGCGGGCAG
CGAGAAGTTCTGCAGTGATCACCACTGGAAATCACCAGCAGCACCACTTC
CAGCACGTTGTGGCCGCCGCCGTTGCAGCCGCCACTTCAGTGGCCACCGG
TCATCAGTTCCAGCAACAGTTCCCGCTGCACGCACATCCGCATCCACAGC
ACCACAGCAACAGTCCCACGGGTAGCGGCAGCAACAGCAACAACAGCGCA
GGTTTCCAGCGCACCAGCATCAGCAACTCGCTGCTGCAGTTCCCGCCGCC
CCCGCCCCCTTCCTCACAGAACCAGGCGAAGGCAGGCCGCACCGTTCAAA
TTGATTGTCGAATTTGAATATACGTCGTCGTCGCCGCCGCTCACCGCCGG
TGCTTACCGCTCTGGGCAGAGCCGCCGTATCAGTTAGTTGTTAACTTGCC
ATCGCCGAAGGAACAAGAGGCGCTAAAAGCGAAACGCGGACGCTGAAATG
AAATCGAATCGAATGTGCACCGCGCACCTGAATTAAATTCGTGGCGAAAA
GGCAAGAATTACTATTCGATTCGTCGTTTTTCTTGCGTGGCTCTTATTTT
TTTTTTTGTCTTGCGGAAGTGTCGCCAGCATCCGCGACTGTTTTCCGTTT
CAGTTCCTAGCTTTTCGTGCTTTCCTCTCAGCTAGCAGTCGTTAGGGTAC
AACTCTTGGCTTCGGTCATATGAAAAAAAAATTTATATAAAAAACAAAAA
ACATGTGAAAAAGTCGGCAACAAGTGCCTGCGAAAAACTGTTTTATTGAC
ACACGTATTTTACATTTTATAAGAACCATAAATGTGTGTTTATAAATAAA
AAGTAAATATTTCAACGCACCCAAAAAGACAGAGAGATAGCGGTGAAGAG
AGTGAGAGAAGAGGGTCACAAATTTTCAGCGTGCGTGTATGTGTGTGTGT
GTGGATAATTGTTGATCAATTGTCATGTGCAAAAAAAAAAAAAAAAAA
LD03241.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:27:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
olf186-F-RC | 1253 | olf186-F-RC | 24..1253 | 1..1230 | 6150 | 100 | Plus |
olf186-F-RE | 4014 | olf186-F-RE | 1..636 | 608..1243 | 3165 | 99.8 | Plus |
olf186-F-RA | 2186 | olf186-F-RA | 68..648 | 1..581 | 2905 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:39:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 13742318..13742968 | 580..1230 | 3240 | 99.8 | Plus |
chr2R | 21145070 | chr2R | 13738063..13738644 | 1..582 | 2835 | 99.1 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:49:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:39:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17855138..17855801 | 580..1243 | 3305 | 99.8 | Plus |
2R | 25286936 | 2R | 17850880..17851461 | 1..582 | 2910 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 17856337..17857000 | 580..1243 | 3305 | 99.8 | Plus |
2R | 25260384 | 2R | 17852079..17852660 | 1..582 | 2910 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 12:39:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6730..6958 | 329..560 | 253 | 60.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6724..6952 | 297..523 | 247 | 59.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6734..6887 | 376..527 | 205 | 63.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6737..6862 | 402..529 | 203 | 65.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6713..6838 | 414..539 | 199 | 66.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2314..2505 | 331..527 | 189 | 58.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6718..6819 | 434..538 | 183 | 71.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2310..2427 | 402..527 | 179 | 65.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6731..6858 | 402..538 | 177 | 64.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2310..2417 | 423..539 | 176 | 67.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2307..2424 | 411..527 | 164 | 61 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2747..2857 | 413..528 | 162 | 65 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2331..2460 | 402..527 | 154 | 62.1 | Plus |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 821..990 | 966..1139 | 149 | 58.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2307..2382 | 452..527 | 145 | 70.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6735..6788 | 474..527 | 143 | 80.4 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1059..1155 | 403..498 | 140 | 61.9 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1052..1148 | 436..527 | 137 | 67 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1054..1154 | 423..527 | 137 | 64.5 | Plus |
looper1 | 1881 | looper1 LOOPER1_DM 1881bp | 1626..1725 | 1033..1120 | 121 | 65 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2588..2643 | 472..527 | 118 | 67.9 | Plus |
LD03241.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:40:40 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 13738063..13738472 | 1..410 | 99 | == | Plus |
chr2R | 13738590..13738643 | 528..581 | 100 | -> | Plus |
chr2R | 13742320..13742968 | 582..1230 | 96 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:02 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RC | 1..399 | 219..617 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:17 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RC | 1..399 | 219..617 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:07:57 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RB | 1..369 | 219..590 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:04 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RC | 1..399 | 219..617 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:50:28 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RB | 1..369 | 219..590 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:46 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RC | 2..1231 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:17 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RC | 2..1231 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:07:57 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RG | 19..1248 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:05 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RC | 2..1231 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:50:28 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
olf186-F-RG | 19..1248 | 1..1230 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:40 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17850880..17851460 | 1..581 | 100 | -> | Plus |
2R | 17855140..17855788 | 582..1230 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:40 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17850880..17851460 | 1..581 | 100 | -> | Plus |
2R | 17855140..17855788 | 582..1230 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:40 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17850880..17851460 | 1..581 | 100 | -> | Plus |
2R | 17855140..17855788 | 582..1230 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:07:57 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13738385..13738965 | 1..581 | 100 | -> | Plus |
arm_2R | 13742645..13743293 | 582..1230 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:31 Download gff for
LD03241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17852079..17852659 | 1..581 | 100 | -> | Plus |
2R | 17856339..17856987 | 582..1230 | 100 | | Plus |
LD03241.pep Sequence
Translation from 218 to 616
> LD03241.pep
MSVWTTANNSGLETPTKSPITSSVPRAARSSAVITTGNHQQHHFQHVVAA
AVAAATSVATGHQFQQQFPLHAHPHPQHHSNSPTGSGSNSNNSAGFQRTS
ISNSLLQFPPPPPPSSQNQAKAGRTVQIDCRI*
LD03241.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:01:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF11682-PA | 604 | GF11682-PA | 1..121 | 1..124 | 237 | 64.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:01:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21831-PA | 353 | GG21831-PA | 1..123 | 1..121 | 382 | 90.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
olf186-F-PF | 351 | CG11430-PF | 1..121 | 1..121 | 640 | 100 | Plus |
olf186-F-PA | 351 | CG11430-PA | 1..121 | 1..121 | 640 | 100 | Plus |
olf186-F-PB | 351 | CG11430-PB | 1..121 | 1..121 | 640 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:01:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21830-PA | 407 | GM21830-PA | 1..121 | 1..121 | 611 | 99.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:01:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11324-PA | 134 | GD11324-PA | 1..134 | 1..132 | 646 | 97.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:01:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11907-PA | 353 | GE11907-PA | 1..123 | 1..121 | 393 | 91.9 | Plus |
LD03241.hyp Sequence
Translation from 218 to 616
> LD03241.hyp
MSVWTTANNSGLETPTKSPITSSVPRAARSSAVITTGNHQQHHFQHVVAA
AVAAATSVATGHQFQQQFPLHAHPHPQHHSNSPTGSGSNSNNSAGFQRTS
ISNSLLQFPPPPPPSSQNQAKAGRTVQIDCRI*
LD03241.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:33:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
olf186-F-PF | 351 | CG11430-PF | 1..121 | 1..121 | 640 | 100 | Plus |
olf186-F-PA | 351 | CG11430-PA | 1..121 | 1..121 | 640 | 100 | Plus |
olf186-F-PB | 351 | CG11430-PB | 1..121 | 1..121 | 640 | 100 | Plus |