Clone LD03241 Report

Search the DGRC for LD03241

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:32
Well:41
Vector:pBS SK-
Associated Gene/Transcriptolf186-F-RC
Protein status:LD03241.pep: wuzgold
Preliminary Size:1384
Sequenced Size:1248

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11430 2003-01-13 Blastp of sequenced clone
olf186-F 2008-04-29 Release 5.5 accounting
olf186-F 2008-08-15 Release 5.9 accounting
olf186-F 2008-12-18 5.12 accounting

Clone Sequence Records

LD03241.complete Sequence

1248 bp (1248 high quality bases) assembled on 2003-01-13

GenBank Submission: BT003591

> LD03241.complete
TTCATACATGCACACAAGTAAAGCATCGAAATGCTGTTGAATTAATTTGT
TTTTTGTTTAGTTTACTTTCAAACCTCGCCGATCGTACTTAATTAGCACC
TTATATTTGCGACGTGTCGAATTGCCTAACTTATTTTGTTACTCTTTTGC
TTGCCTGTTTTTCCGTGCACCATGGCAGACGTACTTAAATCCGCAGGAGA
AATCGCTAGCCAAAAATCATGTCTGTGTGGACCACGGCCAACAATTCGGG
CCTAGAGACGCCAACAAAGTCGCCGATCACGTCGTCGGTTCCGCGGGCAG
CGAGAAGTTCTGCAGTGATCACCACTGGAAATCACCAGCAGCACCACTTC
CAGCACGTTGTGGCCGCCGCCGTTGCAGCCGCCACTTCAGTGGCCACCGG
TCATCAGTTCCAGCAACAGTTCCCGCTGCACGCACATCCGCATCCACAGC
ACCACAGCAACAGTCCCACGGGTAGCGGCAGCAACAGCAACAACAGCGCA
GGTTTCCAGCGCACCAGCATCAGCAACTCGCTGCTGCAGTTCCCGCCGCC
CCCGCCCCCTTCCTCACAGAACCAGGCGAAGGCAGGCCGCACCGTTCAAA
TTGATTGTCGAATTTGAATATACGTCGTCGTCGCCGCCGCTCACCGCCGG
TGCTTACCGCTCTGGGCAGAGCCGCCGTATCAGTTAGTTGTTAACTTGCC
ATCGCCGAAGGAACAAGAGGCGCTAAAAGCGAAACGCGGACGCTGAAATG
AAATCGAATCGAATGTGCACCGCGCACCTGAATTAAATTCGTGGCGAAAA
GGCAAGAATTACTATTCGATTCGTCGTTTTTCTTGCGTGGCTCTTATTTT
TTTTTTTGTCTTGCGGAAGTGTCGCCAGCATCCGCGACTGTTTTCCGTTT
CAGTTCCTAGCTTTTCGTGCTTTCCTCTCAGCTAGCAGTCGTTAGGGTAC
AACTCTTGGCTTCGGTCATATGAAAAAAAAATTTATATAAAAAACAAAAA
ACATGTGAAAAAGTCGGCAACAAGTGCCTGCGAAAAACTGTTTTATTGAC
ACACGTATTTTACATTTTATAAGAACCATAAATGTGTGTTTATAAATAAA
AAGTAAATATTTCAACGCACCCAAAAAGACAGAGAGATAGCGGTGAAGAG
AGTGAGAGAAGAGGGTCACAAATTTTCAGCGTGCGTGTATGTGTGTGTGT
GTGGATAATTGTTGATCAATTGTCATGTGCAAAAAAAAAAAAAAAAAA

LD03241.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-RC 1253 olf186-F-RC 24..1253 1..1230 6150 100 Plus
olf186-F-RE 4014 olf186-F-RE 1..636 608..1243 3165 99.8 Plus
olf186-F-RA 2186 olf186-F-RA 68..648 1..581 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13742318..13742968 580..1230 3240 99.8 Plus
chr2R 21145070 chr2R 13738063..13738644 1..582 2835 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:49:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17855138..17855801 580..1243 3305 99.8 Plus
2R 25286936 2R 17850880..17851461 1..582 2910 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17856337..17857000 580..1243 3305 99.8 Plus
2R 25260384 2R 17852079..17852660 1..582 2910 100 Plus
Blast to na_te.dros performed 2019-03-16 12:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6730..6958 329..560 253 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6952 297..523 247 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6887 376..527 205 63.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6862 402..529 203 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6838 414..539 199 66.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2314..2505 331..527 189 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6819 434..538 183 71.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2427 402..527 179 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6858 402..538 177 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2417 423..539 176 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2424 411..527 164 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2857 413..528 162 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2460 402..527 154 62.1 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 821..990 966..1139 149 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2382 452..527 145 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6788 474..527 143 80.4 Plus
roo 9092 roo DM_ROO 9092bp 1059..1155 403..498 140 61.9 Plus
roo 9092 roo DM_ROO 9092bp 1052..1148 436..527 137 67 Plus
roo 9092 roo DM_ROO 9092bp 1054..1154 423..527 137 64.5 Plus
looper1 1881 looper1 LOOPER1_DM 1881bp 1626..1725 1033..1120 121 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2588..2643 472..527 118 67.9 Plus

LD03241.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:40:40 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13738063..13738472 1..410 99 == Plus
chr2R 13738590..13738643 528..581 100 -> Plus
chr2R 13742320..13742968 582..1230 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:02 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 1..399 219..617 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:17 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 1..399 219..617 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:07:57 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RB 1..369 219..590 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:04 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 1..399 219..617 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:50:28 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RB 1..369 219..590 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:46 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 2..1231 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:17 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 2..1231 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:07:57 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 19..1248 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:05 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 2..1231 1..1230 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:50:28 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 19..1248 1..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:40 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17850880..17851460 1..581 100 -> Plus
2R 17855140..17855788 582..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:40 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17850880..17851460 1..581 100 -> Plus
2R 17855140..17855788 582..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:40 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17850880..17851460 1..581 100 -> Plus
2R 17855140..17855788 582..1230 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:07:57 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13738385..13738965 1..581 100 -> Plus
arm_2R 13742645..13743293 582..1230 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:31 Download gff for LD03241.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17852079..17852659 1..581 100 -> Plus
2R 17856339..17856987 582..1230 100   Plus

LD03241.pep Sequence

Translation from 218 to 616

> LD03241.pep
MSVWTTANNSGLETPTKSPITSSVPRAARSSAVITTGNHQQHHFQHVVAA
AVAAATSVATGHQFQQQFPLHAHPHPQHHSNSPTGSGSNSNNSAGFQRTS
ISNSLLQFPPPPPPSSQNQAKAGRTVQIDCRI*

LD03241.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11682-PA 604 GF11682-PA 1..121 1..124 237 64.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21831-PA 353 GG21831-PA 1..123 1..121 382 90.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-PF 351 CG11430-PF 1..121 1..121 640 100 Plus
olf186-F-PA 351 CG11430-PA 1..121 1..121 640 100 Plus
olf186-F-PB 351 CG11430-PB 1..121 1..121 640 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21830-PA 407 GM21830-PA 1..121 1..121 611 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11324-PA 134 GD11324-PA 1..134 1..132 646 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11907-PA 353 GE11907-PA 1..123 1..121 393 91.9 Plus

LD03241.hyp Sequence

Translation from 218 to 616

> LD03241.hyp
MSVWTTANNSGLETPTKSPITSSVPRAARSSAVITTGNHQQHHFQHVVAA
AVAAATSVATGHQFQQQFPLHAHPHPQHHSNSPTGSGSNSNNSAGFQRTS
ISNSLLQFPPPPPPSSQNQAKAGRTVQIDCRI*

LD03241.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-PF 351 CG11430-PF 1..121 1..121 640 100 Plus
olf186-F-PA 351 CG11430-PA 1..121 1..121 640 100 Plus
olf186-F-PB 351 CG11430-PB 1..121 1..121 640 100 Plus