Clone LD03247 Report

Search the DGRC for LD03247

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:32
Well:47
Vector:pBS SK-
Associated Gene/TranscriptPomp-RA
Protein status:LD03247.pep: gold
Preliminary Size:1227
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9324 2001-01-01 Release 2 assignment
CG9324 2001-10-10 Blastp of sequenced clone
CG9324 2003-01-01 Sim4 clustering to Release 3
Pomp 2008-04-29 Release 5.5 accounting
Pomp 2008-08-15 Release 5.9 accounting
Pomp 2008-12-18 5.12 accounting

Clone Sequence Records

LD03247.complete Sequence

1076 bp (1076 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061060

> LD03247.complete
CACAAGTACCAGCTCTAATTCGCACGGAATTTGTTTGTCATTCAAGAAAC
AATTATAATTCGCCGCATTTTTATTCTAAAAGCGCTTACGAATATGTATC
AGCCATCACTGAAAGTCCAGCCCGCCGAGGTGTCCGTGCTGAACGCCACC
GGCCGTGTGGGAATGCCCACCGAGGCCAACTGCCTGAACCAACTGGCCCA
CGTCCACCGGCTGCGCGACTCGGAGCTGAACTACAACGAGCACCAGTACA
ACCGCAACATGCAGATGCTGCGCAACCACGAGGGCCTCGGCGTGCCCCTC
AAGATGGGCATGGAGCGCTTCGCCGCACGTCAGGTGGGCCGCCTGCCCTT
CCTTTCGTCCAGCAACTTCATGGACGATGTCCTGACTGGCCGCTGTGATT
CCATTGGCTTCGAGGACTTCATGAACTTGCCCGAGAACAGCGAGCATATG
CGTCAGCCCCACGCTGTGGTGGAGAAATCTCTGGGAATTTACCAATAAGT
CCCTGCAAATGAAGTTGCTAAATGCCTGGCATTCAGCCTTTAAACTCTAA
GACACTCTTAAGATCAGCAAATAAAATATATTTTGGTGCGACCAGCTAGA
GGTAAACAAAATTCACCATTTCTTTGAGCCAAATTTATTCGTATTTCGTT
TGTTTAACTCCACATCAATACATTTAACTAGTTCGTTAAACTTACACATT
TTATTCAAACAAATCTAAAAACTACACGAAAATATTGGCAGAAGGTTGTT
GTACTGAGGAGATTCGTTAAAATAATAAACTGAAGAGATATGCGTTGACA
TCATTCATTATTTGTAAAAATAAAACAAGAGATGGTAAAATGGACGAATT
CGTTTCGTAAAATTAGGCTTATACTTAAGGAAAACTGAATTGTAAACGGA
GGGCGCATTTCAACTTATACAAACATTGCATATATACATGATTTATATTT
AAAGAGGAAAATGACAGTAATTGAGATAAACATAGTTAATAAAACGCATT
ACATTCCTCAAGCAAAACACGTCTAATCAACAATAAATATTGAAATCGCT
AGCGTTTTAAAAAAAAAAAAAAAAAA

LD03247.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Pomp-RA 1155 Pomp-RA 96..1155 1..1060 5300 100 Plus
vari-RD 2735 vari-RD 2276..2735 1061..602 2300 100 Minus
vari-RB 2800 vari-RB 2341..2800 1061..602 2300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20786905..20787603 360..1058 3480 99.9 Plus
chr2L 23010047 chr2L 20786354..20786620 96..362 1335 100 Plus
chr2L 23010047 chr2L 20786195..20786290 1..96 450 97.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:49:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20788400..20789101 360..1061 3510 100 Plus
2L 23513712 2L 20787849..20788115 96..362 1335 100 Plus
2L 23513712 2L 20787690..20787785 1..96 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20788400..20789101 360..1061 3510 100 Plus
2L 23513712 2L 20787849..20788115 96..362 1335 100 Plus
2L 23513712 2L 20787690..20787785 1..96 480 100 Plus
Blast to na_te.dros performed 2019-03-15 19:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 4082..4153 964..1037 130 67.6 Plus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 2228..2356 688..808 129 61.2 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 2634..2701 968..1037 128 68.6 Plus

LD03247.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:35:02 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20786195..20786290 1..96 97 -> Plus
chr2L 20786355..20786620 97..362 100 -> Plus
chr2L 20786908..20787603 363..1058 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:03 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 1..405 94..498 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:01 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 1..405 94..498 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:54:27 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 1..405 94..498 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:50 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 1..405 94..498 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:00 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 1..405 94..498 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:33 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 42..1099 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:01 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 42..1099 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:54:27 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 35..1092 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:50 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 42..1099 1..1058 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:00 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
Pomp-RA 35..1092 1..1058 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:35:02 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20787690..20787785 1..96 100 -> Plus
2L 20787850..20788115 97..362 100 -> Plus
2L 20788403..20789098 363..1058 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:35:02 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20787690..20787785 1..96 100 -> Plus
2L 20787850..20788115 97..362 100 -> Plus
2L 20788403..20789098 363..1058 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:35:02 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20787690..20787785 1..96 100 -> Plus
2L 20787850..20788115 97..362 100 -> Plus
2L 20788403..20789098 363..1058 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:54:27 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20787690..20787785 1..96 100 -> Plus
arm_2L 20787850..20788115 97..362 100 -> Plus
arm_2L 20788403..20789098 363..1058 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:44 Download gff for LD03247.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20787850..20788115 97..362 100 -> Plus
2L 20788403..20789098 363..1058 100   Plus
2L 20787690..20787785 1..96 100 -> Plus

LD03247.pep Sequence

Translation from 93 to 497

> LD03247.pep
MYQPSLKVQPAEVSVLNATGRVGMPTEANCLNQLAHVHRLRDSELNYNEH
QYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLPFLSSSNFMDDVLTGR
CDSIGFEDFMNLPENSEHMRQPHAVVEKSLGIYQ*

LD03247.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15356-PA 133 GF15356-PA 1..133 1..133 595 82.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21253-PA 134 GG21253-PA 1..133 1..133 667 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11620-PA 134 GH11620-PA 1..133 1..133 565 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Pomp-PA 134 CG9324-PA 1..134 1..134 706 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17923-PA 150 GI17923-PA 19..149 3..133 543 74 Plus
Dmoj\GI21382-PA 124 GI21382-PA 2..122 12..132 293 46.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18520-PA 133 GL18520-PA 1..133 1..133 574 80.5 Plus
Dper\GL16162-PA 126 GL16162-PA 35..124 40..129 187 43.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21701-PA 133 GA21701-PA 1..133 1..133 574 80.5 Plus
Dpse\GA27720-PA 126 GA27720-PA 35..124 40..129 187 43.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23371-PA 134 GM23371-PA 1..134 1..134 689 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24281-PA 134 GD24281-PA 1..134 1..134 689 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17695-PA 148 GJ17695-PA 17..147 3..133 564 77.1 Plus
Dvir\GJ15569-PA 124 GJ15569-PA 4..122 14..132 390 58.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14916-PA 134 GK14916-PA 5..133 5..133 587 82.9 Plus
Dwil\GK20995-PA 80 GK20995-PA 5..79 60..134 283 66.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12348-PA 134 GE12348-PA 1..133 1..133 664 94.7 Plus

LD03247.hyp Sequence

Translation from 93 to 497

> LD03247.hyp
MYQPSLKVQPAEVSVLNATGRVGMPTEANCLNQLAHVHRLRDSELNYNEH
QYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLPFLSSSNFMDDVLTGR
CDSIGFEDFMNLPENSEHMRQPHAVVEKSLGIYQ*

LD03247.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Pomp-PA 134 CG9324-PA 1..134 1..134 706 100 Plus