BDGP Sequence Production Resources |
Search the DGRC for LD03247
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 32 |
Well: | 47 |
Vector: | pBS SK- |
Associated Gene/Transcript | Pomp-RA |
Protein status: | LD03247.pep: gold |
Preliminary Size: | 1227 |
Sequenced Size: | 1076 |
Gene | Date | Evidence |
---|---|---|
CG9324 | 2001-01-01 | Release 2 assignment |
CG9324 | 2001-10-10 | Blastp of sequenced clone |
CG9324 | 2003-01-01 | Sim4 clustering to Release 3 |
Pomp | 2008-04-29 | Release 5.5 accounting |
Pomp | 2008-08-15 | Release 5.9 accounting |
Pomp | 2008-12-18 | 5.12 accounting |
1076 bp (1076 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061060
> LD03247.complete CACAAGTACCAGCTCTAATTCGCACGGAATTTGTTTGTCATTCAAGAAAC AATTATAATTCGCCGCATTTTTATTCTAAAAGCGCTTACGAATATGTATC AGCCATCACTGAAAGTCCAGCCCGCCGAGGTGTCCGTGCTGAACGCCACC GGCCGTGTGGGAATGCCCACCGAGGCCAACTGCCTGAACCAACTGGCCCA CGTCCACCGGCTGCGCGACTCGGAGCTGAACTACAACGAGCACCAGTACA ACCGCAACATGCAGATGCTGCGCAACCACGAGGGCCTCGGCGTGCCCCTC AAGATGGGCATGGAGCGCTTCGCCGCACGTCAGGTGGGCCGCCTGCCCTT CCTTTCGTCCAGCAACTTCATGGACGATGTCCTGACTGGCCGCTGTGATT CCATTGGCTTCGAGGACTTCATGAACTTGCCCGAGAACAGCGAGCATATG CGTCAGCCCCACGCTGTGGTGGAGAAATCTCTGGGAATTTACCAATAAGT CCCTGCAAATGAAGTTGCTAAATGCCTGGCATTCAGCCTTTAAACTCTAA GACACTCTTAAGATCAGCAAATAAAATATATTTTGGTGCGACCAGCTAGA GGTAAACAAAATTCACCATTTCTTTGAGCCAAATTTATTCGTATTTCGTT TGTTTAACTCCACATCAATACATTTAACTAGTTCGTTAAACTTACACATT TTATTCAAACAAATCTAAAAACTACACGAAAATATTGGCAGAAGGTTGTT GTACTGAGGAGATTCGTTAAAATAATAAACTGAAGAGATATGCGTTGACA TCATTCATTATTTGTAAAAATAAAACAAGAGATGGTAAAATGGACGAATT CGTTTCGTAAAATTAGGCTTATACTTAAGGAAAACTGAATTGTAAACGGA GGGCGCATTTCAACTTATACAAACATTGCATATATACATGATTTATATTT AAAGAGGAAAATGACAGTAATTGAGATAAACATAGTTAATAAAACGCATT ACATTCCTCAAGCAAAACACGTCTAATCAACAATAAATATTGAAATCGCT AGCGTTTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 20786905..20787603 | 360..1058 | 3480 | 99.9 | Plus |
chr2L | 23010047 | chr2L | 20786354..20786620 | 96..362 | 1335 | 100 | Plus |
chr2L | 23010047 | chr2L | 20786195..20786290 | 1..96 | 450 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 20788400..20789101 | 360..1061 | 3510 | 100 | Plus |
2L | 23513712 | 2L | 20787849..20788115 | 96..362 | 1335 | 100 | Plus |
2L | 23513712 | 2L | 20787690..20787785 | 1..96 | 480 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 20788400..20789101 | 360..1061 | 3510 | 100 | Plus |
2L | 23513712 | 2L | 20787849..20788115 | 96..362 | 1335 | 100 | Plus |
2L | 23513712 | 2L | 20787690..20787785 | 1..96 | 480 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-C | 11124 | TART-C TARTC 11124bp | 4082..4153 | 964..1037 | 130 | 67.6 | Plus |
297 | 6995 | 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). | 2228..2356 | 688..808 | 129 | 61.2 | Plus |
Dyak\TART | 8444 | Dyak\TART TARTYAK 8444bp | 2634..2701 | 968..1037 | 128 | 68.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 20786195..20786290 | 1..96 | 97 | -> | Plus |
chr2L | 20786355..20786620 | 97..362 | 100 | -> | Plus |
chr2L | 20786908..20787603 | 363..1058 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 1..405 | 94..498 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 1..405 | 94..498 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 1..405 | 94..498 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 1..405 | 94..498 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 1..405 | 94..498 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 42..1099 | 1..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 42..1099 | 1..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 35..1092 | 1..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 42..1099 | 1..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Pomp-RA | 35..1092 | 1..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20787690..20787785 | 1..96 | 100 | -> | Plus |
2L | 20787850..20788115 | 97..362 | 100 | -> | Plus |
2L | 20788403..20789098 | 363..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20787690..20787785 | 1..96 | 100 | -> | Plus |
2L | 20787850..20788115 | 97..362 | 100 | -> | Plus |
2L | 20788403..20789098 | 363..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20787690..20787785 | 1..96 | 100 | -> | Plus |
2L | 20787850..20788115 | 97..362 | 100 | -> | Plus |
2L | 20788403..20789098 | 363..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 20787690..20787785 | 1..96 | 100 | -> | Plus |
arm_2L | 20787850..20788115 | 97..362 | 100 | -> | Plus |
arm_2L | 20788403..20789098 | 363..1058 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20787850..20788115 | 97..362 | 100 | -> | Plus |
2L | 20788403..20789098 | 363..1058 | 100 | Plus | |
2L | 20787690..20787785 | 1..96 | 100 | -> | Plus |
Translation from 93 to 497
> LD03247.pep MYQPSLKVQPAEVSVLNATGRVGMPTEANCLNQLAHVHRLRDSELNYNEH QYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLPFLSSSNFMDDVLTGR CDSIGFEDFMNLPENSEHMRQPHAVVEKSLGIYQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15356-PA | 133 | GF15356-PA | 1..133 | 1..133 | 595 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21253-PA | 134 | GG21253-PA | 1..133 | 1..133 | 667 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11620-PA | 134 | GH11620-PA | 1..133 | 1..133 | 565 | 76.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pomp-PA | 134 | CG9324-PA | 1..134 | 1..134 | 706 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17923-PA | 150 | GI17923-PA | 19..149 | 3..133 | 543 | 74 | Plus |
Dmoj\GI21382-PA | 124 | GI21382-PA | 2..122 | 12..132 | 293 | 46.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18520-PA | 133 | GL18520-PA | 1..133 | 1..133 | 574 | 80.5 | Plus |
Dper\GL16162-PA | 126 | GL16162-PA | 35..124 | 40..129 | 187 | 43.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21701-PA | 133 | GA21701-PA | 1..133 | 1..133 | 574 | 80.5 | Plus |
Dpse\GA27720-PA | 126 | GA27720-PA | 35..124 | 40..129 | 187 | 43.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23371-PA | 134 | GM23371-PA | 1..134 | 1..134 | 689 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24281-PA | 134 | GD24281-PA | 1..134 | 1..134 | 689 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17695-PA | 148 | GJ17695-PA | 17..147 | 3..133 | 564 | 77.1 | Plus |
Dvir\GJ15569-PA | 124 | GJ15569-PA | 4..122 | 14..132 | 390 | 58.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14916-PA | 134 | GK14916-PA | 5..133 | 5..133 | 587 | 82.9 | Plus |
Dwil\GK20995-PA | 80 | GK20995-PA | 5..79 | 60..134 | 283 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12348-PA | 134 | GE12348-PA | 1..133 | 1..133 | 664 | 94.7 | Plus |
Translation from 93 to 497
> LD03247.hyp MYQPSLKVQPAEVSVLNATGRVGMPTEANCLNQLAHVHRLRDSELNYNEH QYNRNMQMLRNHEGLGVPLKMGMERFAARQVGRLPFLSSSNFMDDVLTGR CDSIGFEDFMNLPENSEHMRQPHAVVEKSLGIYQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Pomp-PA | 134 | CG9324-PA | 1..134 | 1..134 | 706 | 100 | Plus |