Clone LD03453 Report

Search the DGRC for LD03453

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:34
Well:53
Vector:pBS SK-
Associated Gene/TranscriptGgamma1-RA
Protein status:LD03453.pep: gold
Preliminary Size:1310
Sequenced Size:1096

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8261 2001-01-01 Release 2 assignment
CG8261 2002-05-31 Blastp of sequenced clone
CG8261 2003-01-01 Sim4 clustering to Release 3
Ggamma1 2008-04-29 Release 5.5 accounting
Ggamma1 2008-08-15 Release 5.9 accounting
Ggamma1 2008-12-18 5.12 accounting

Clone Sequence Records

LD03453.complete Sequence

1096 bp (1096 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118489

> LD03453.complete
TCAACTTTGCTCGATTTTAGCCCGTAGAGTTCGAGATTTAAAAAAAAAAA
AAACATATAAGCCGGAGCTGCCAGCCATTAAGATCCATCCAAACCAGTAT
TCCCAGAATCATACGATAAGATAAGCCAAAGCCAAAGATCAAAGACCAAG
CCCTTCGGCGAAGCCACACAAGCACTAGCAACCAAGCACACCACCCCAAA
TCCACTATCCCGTAATTGCATTTCCCAGTATCCGTAACACTGAGAACCTT
TTCAACCATAGGCCTATCCGAGACAGCCATCATGGACGTAATGTCATCAT
CCCTGCAGCAGCAGCGCGTCGTGGTGGAGCAGCTGCGTCGCGAGGCTGCC
ATCGACCGCCAGACGATCTCGGAGTCATGCGCTAAGATGATGAAGTACAT
CACGGAGCACGAGCAGGAGGACTACCTGCTCACCGGGTTCACCAGCCAGA
AGGTGAATCCCTTCCGCGAGAAGTCGTCCTGCACCGTTCTCTAAGGAGGC
GGTGAGGATGGTCCGCCGTTGCCGAGGAGTCAGCGATCGCCGGCGGACGT
TTAGCTTATTTTTAGTTTAGCAAGATGGATTAGGACGCAAACGTGTGTGG
AGTACTACCCCAGTACCAGTATCAACGCCACCTGGAACAATATATAGTTG
TGCAGAAGCCACAAAAGCTACGATTGTCATAAGCAATATCATTACAAGAA
GTTTGAATTCCAATTCTAATTCCAATTGCGAGGAATATATATATATATTT
GAATCGATATATCAATGTGTACCAGCCACGTTAACAAGTAATGTCCGAAA
CCAGAAACACAAACTCAATGTCAAACCTAAATCTATATCTAAATCTAAAT
CGAAGCATTTGTTCCAAAGATATCAGAGTTGTTTCCTTTCCGATGAGTAA
CGCAGTTAATGTACACGAATATCCCAACTATAACGACAATTAATGCGCTG
ACTATAGCACCTACTACTCTACCTAACCCGAAATTCTATATATACAAAAC
TATCAACTTAATCCGACATACAAATTTATCAATAAACGCAAACTCAGTCG
AAACGGAAATACATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD03453.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-RB 1476 Ggamma1-RB 51..1115 1..1065 5325 100 Plus
Ggamma1.l 2773 Ggamma1.l 51..1115 1..1065 5325 100 Plus
Ggamma1.f 1009 Ggamma1.f 207..1009 262..1064 4015 100 Plus
Ggamma1.f 1009 Ggamma1.f 1..207 2..212 970 98.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4789687..4790681 70..1064 4975 100 Plus
chr2R 21145070 chr2R 4789006..4789073 1..70 285 97.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:49:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8902136..8903131 70..1065 4980 100 Plus
2R 25286936 2R 8901453..8901522 1..70 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8903335..8904330 70..1065 4980 100 Plus
2R 25260384 2R 8902652..8902721 1..70 350 100 Plus
2R 25260384 2R 17565060..17565162 367..472 205 81.1 Plus
Blast to na_te.dros performed on 2019-03-16 06:56:06 has no hits.

LD03453.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:57:01 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4789006..4789073 1..70 97 -> Plus
chr2R 4789688..4790681 71..1064 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:31 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RC 1..213 282..494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:26 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RC 1..213 282..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:04 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RA 1..213 282..494 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:26:01 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RC 1..213 282..494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:04 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RA 1..213 282..494 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:37 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 51..1114 1..1064 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:26 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 51..1114 1..1064 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:04 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 21..1084 1..1064 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:26:02 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 51..1114 1..1064 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:04 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 21..1084 1..1064 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:01 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8901453..8901522 1..70 100 -> Plus
2R 8902137..8903130 71..1064 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:01 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8901453..8901522 1..70 100 -> Plus
2R 8902137..8903130 71..1064 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:01 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8901453..8901522 1..70 100 -> Plus
2R 8902137..8903130 71..1064 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:04 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4788958..4789027 1..70 100 -> Plus
arm_2R 4789642..4790635 71..1064 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:27 Download gff for LD03453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8903336..8904329 71..1064 100   Plus
2R 8902652..8902721 1..70 100 -> Plus

LD03453.hyp Sequence

Translation from 281 to 493

> LD03453.hyp
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLL
TGFTSQKVNPFREKSSCTVL*

LD03453.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-PC 70 CG8261-PC 1..70 1..70 349 100 Plus
Ggamma1-PB 70 CG8261-PB 1..70 1..70 349 100 Plus
Ggamma1-PA 70 CG8261-PA 1..70 1..70 349 100 Plus
CG43324-PA 66 CG43324-PA 1..66 4..70 209 61.2 Plus

LD03453.pep Sequence

Translation from 281 to 493

> LD03453.pep
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLL
TGFTSQKVNPFREKSSCTVL*

LD03453.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12388-PA 70 GF12388-PA 1..70 1..70 358 97.1 Plus
Dana\GF11642-PA 802 GF11642-PA 734..802 1..70 247 62.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23393-PA 70 GG23393-PA 1..70 1..70 364 100 Plus
Dere\GG21798-PA 844 GG21798-PA 776..844 1..70 227 58.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23107-PA 70 GH23107-PA 1..70 1..70 332 90 Plus
Dgri\GH20923-PA 67 GH20923-PA 1..67 4..70 241 62.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-PC 70 CG8261-PC 1..70 1..70 349 100 Plus
Ggamma1-PB 70 CG8261-PB 1..70 1..70 349 100 Plus
Ggamma1-PA 70 CG8261-PA 1..70 1..70 349 100 Plus
CG43324-PA 66 CG43324-PA 1..66 4..70 209 61.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18930-PA 70 GI18930-PA 1..70 1..70 328 88.6 Plus
Dmoj\GI18361-PA 67 GI18361-PA 1..67 4..70 248 65.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11674-PA 70 GL11674-PA 1..70 1..70 347 92.9 Plus
Dper\GL11466-PA 836 GL11466-PA 767..836 1..70 231 58.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20938-PA 70 GA20938-PA 1..70 1..70 347 92.9 Plus
Dpse\GA24739-PA 67 GA24739-PA 1..67 4..70 221 59.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21074-PA 70 GM21074-PA 1..70 1..70 364 100 Plus
Dsec\GM21801-PA 66 GM21801-PA 1..66 4..70 217 61.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10610-PA 70 GD10610-PA 1..70 1..70 355 98.6 Plus
Dsim\GD11290-PA 541 GD11290-PA 473..541 1..70 230 60 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21302-PA 70 GJ21302-PA 1..70 1..70 325 87.1 Plus
Dvir\GJ21430-PA 67 GJ21430-PA 1..67 4..70 245 64.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20682-PA 70 GK20682-PA 1..70 1..70 352 94.3 Plus
Dwil\GK21901-PA 808 GK21901-PA 739..808 1..70 251 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19235-PA 70 GE19235-PA 1..70 1..70 364 100 Plus
Dyak\GE11873-PA 810 GE11873-PA 742..810 1..70 228 60 Plus