Clone LD03460 Report

Search the DGRC for LD03460

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:34
Well:60
Vector:pBS SK-
Associated Gene/TranscriptCG6845-RD
Protein status:LD03460.pep: validated not full length
Sequenced Size:1013

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6845 2003-01-01 Sim4 clustering to Release 3
CG6845 2004-03-31 Blastp of sequenced clone
CG6845 2008-04-29 Release 5.5 accounting
CG6845 2008-08-15 Release 5.9 accounting
CG6845 2008-12-18 5.12 accounting

Clone Sequence Records

LD03460.complete Sequence

1013 bp (1013 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012492

> LD03460.complete
AGAAAGTCAGCCAAGGTATGGCGCTATGTGGACATTCAAGCTGGTGGCAC
CATACGTAATTGGCGGCTACCTATGCGGCCTCGCGGTAACGCTCGCATGG
AACTGGTGGCAGCTGGGCCACTTGGTTCTGGGTCTTAATCTCACCTTCGC
GATTCCGGTGGCGCTTGTTCTGGCGGTCTTTTACAGCAGGCCCGTAAGGT
GCATTGTGACTTTGGCCCTTCCCTCGCTGTGCAGCTCTCGGGGAAGGGCG
TTCCTCATCAGCCTTGCCTTTGTTATTGCCGCAGTTGGGCCTACGGCGAA
CATTCTAGCCAATTTGAAGGTGATGCTCCGCAGCCTCGCTTGCGGACAGG
AGCTATTGCGTCAGGCGCTTGGCCAGATGTTGGACGTAATACTGGAGCCG
GTGAATGCCATCCAGCTAGCGGTGGATCTCTTGATGCGGGAAGTGCGTCG
GGTGCTCAAGCTGGCCATGGTAGTGCTGTTACGCATTCAGGACCAATTGA
TCGCAATTACAAGCATTTTTAAGTTTATCCGCCGCAGAAAGCGTAATGAG
TTTAACCACACACGGAATGTGAAGCACACCAGAAACTACACTTGGCTGAA
CAATAGATTCTCCTGTTTAATGTGCATGTGCTCCTGCTGCTCATCCTGTC
AAAGCACTGAGAGGTGCACCATATGTGGCCGATCTCTGACTCTTTCAAAT
CGTAACCCCTGCGACACTCCTGGATGCAAAGGGGTTTATTGCGGTAAATG
CTTTGAAAAGTCACACAATAAGTGTTGTCTGTGCAATCGACCAGTGGATT
ATGGTGATTTTTCCGACGTTACTGAAGTAGACGACTCTTCGGACTATTCT
GAAAAAGAGTCTTTTAGCGAAAGGCAGTACAGGAAGACCTGTGGAGGACA
ACGCTAGCAACGAGGGAAAAACAGTTAAACATAGAGGTTGTGAGCGCATA
CACGTTATGCAGATAGCTCAGAAATATAATATTTCCACCTATTAAAAAAA
AAAAAAAAAAAAA

LD03460.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6845-RD 1143 CG6845-RD 84..1079 1..996 4980 100 Plus
CG6845-RE 2398 CG6845-RE 91..599 1..509 2545 100 Plus
CG6845-RC 2223 CG6845-RC 57..565 1..509 2545 100 Plus
CG6845-RE 2398 CG6845-RE 1824..2311 509..996 2440 100 Plus
CG6845-RC 2223 CG6845-RC 1672..2159 509..996 2440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 146732..147044 197..509 1565 100 Plus
chr3L 24539361 chr3L 146471..146670 1..200 1000 100 Plus
chr3L 24539361 chr3L 148424..148607 510..693 920 100 Plus
chr3L 24539361 chr3L 148857..149018 832..993 810 100 Plus
chr3L 24539361 chr3L 148666..148803 694..831 690 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:50:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 146770..147082 197..509 1565 100 Plus
3L 28110227 3L 146509..146708 1..200 1000 100 Plus
3L 28110227 3L 148462..148645 510..693 920 100 Plus
3L 28110227 3L 148895..149059 832..996 825 100 Plus
3L 28110227 3L 148704..148841 694..831 690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 146770..147082 197..509 1565 100 Plus
3L 28103327 3L 146509..146708 1..200 1000 100 Plus
3L 28103327 3L 148462..148645 510..693 920 100 Plus
3L 28103327 3L 148895..149059 832..996 825 100 Plus
3L 28103327 3L 148704..148841 694..831 690 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:57:18 has no hits.

LD03460.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:57:58 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 146471..146668 1..198 100 -> Plus
chr3L 146734..147044 199..509 100 -> Plus
chr3L 148424..148607 510..693 100 -> Plus
chr3L 148666..148803 694..831 100 -> Plus
chr3L 148857..149018 832..993 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:36 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 6..912 1..907 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:38:35 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 6..912 1..907 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:03:10 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 6..912 1..907 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:19 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 6..912 1..907 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:16 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 6..912 1..907 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:46:36 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 57..1049 1..993 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:38:35 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 57..1049 1..993 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:03:10 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 77..1069 1..993 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:19 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 57..1049 1..993 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:16 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
CG6845-RD 77..1069 1..993 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:58 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
3L 146772..147082 199..509 100 -> Plus
3L 146509..146706 1..198 100 -> Plus
3L 148462..148645 510..693 100 -> Plus
3L 148704..148841 694..831 100 -> Plus
3L 148895..149056 832..993 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:58 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
3L 146772..147082 199..509 100 -> Plus
3L 146509..146706 1..198 100 -> Plus
3L 148462..148645 510..693 100 -> Plus
3L 148704..148841 694..831 100 -> Plus
3L 148895..149056 832..993 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:58 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
3L 146772..147082 199..509 100 -> Plus
3L 146509..146706 1..198 100 -> Plus
3L 148462..148645 510..693 100 -> Plus
3L 148704..148841 694..831 100 -> Plus
3L 148895..149056 832..993 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:03:10 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 146509..146706 1..198 100 -> Plus
arm_3L 146772..147082 199..509 100 -> Plus
arm_3L 148462..148645 510..693 100 -> Plus
arm_3L 148704..148841 694..831 100 -> Plus
arm_3L 148895..149056 832..993 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:59:46 Download gff for LD03460.complete
Subject Subject Range Query Range Percent Splice Strand
3L 146772..147082 199..509 100 -> Plus
3L 148462..148645 510..693 100 -> Plus
3L 148704..148841 694..831 100 -> Plus
3L 148895..149056 832..993 100   Plus
3L 146509..146706 1..198 100 -> Plus

LD03460.hyp Sequence

Translation from 0 to 906

> LD03460.hyp
ESQPRYGAMWTFKLVAPYVIGGYLCGLAVTLAWNWWQLGHLVLGLNLTFA
IPVALVLAVFYSRPVRCIVTLALPSLCSSRGRAFLISLAFVIAAVGPTAN
ILANLKVMLRSLACGQELLRQALGQMLDVILEPVNAIQLAVDLLMREVRR
VLKLAMVVLLRIQDQLIAITSIFKFIRRRKRNEFNHTRNVKHTRNYTWLN
NRFSCLMCMCSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKC
FEKSHNKCCLCNRPVDYGDFSDVTEVDDSSDYSEKESFSERQYRKTCGGQ
R*

LD03460.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6845-PD 303 CG6845-PD 3..303 1..301 1601 100 Plus
CG6845-PC 672 CG6845-PC 3..176 1..174 846 97.7 Plus
CG6845-PC 672 CG6845-PC 541..672 170..301 758 100 Plus
CG6845-PE 334 CG6845-PE 203..334 170..301 758 100 Plus
CG32320-PD 767 CG32320-PD 100..259 18..174 211 33.1 Plus
CG32320-PD 767 CG32320-PD 636..751 179..286 156 31.1 Plus

LD03460.pep Sequence

Translation from 1 to 906

> LD03460.pep
ESQPRYGAMWTFKLVAPYVIGGYLCGLAVTLAWNWWQLGHLVLGLNLTFA
IPVALVLAVFYSRPVRCIVTLALPSLCSSRGRAFLISLAFVIAAVGPTAN
ILANLKVMLRSLACGQELLRQALGQMLDVILEPVNAIQLAVDLLMREVRR
VLKLAMVVLLRIQDQLIAITSIFKFIRRRKRNEFNHTRNVKHTRNYTWLN
NRFSCLMCMCSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKC
FEKSHNKCCLCNRPVDYGDFSDVTEVDDSSDYSEKESFSERQYRKTCGGQ
R*

LD03460.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24881-PA 692 GF24881-PA 1..175 9..179 487 57.7 Plus
Dana\GF24881-PA 692 GF24881-PA 557..683 171..298 337 49.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14692-PA 672 GG14692-PA 3..176 1..174 731 88.5 Plus
Dere\GG14692-PA 672 GG14692-PA 541..672 170..301 708 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15478-PA 659 GH15478-PA 14..163 10..156 392 56.7 Plus
Dgri\GH15478-PA 659 GH15478-PA 582..648 232..299 219 57.4 Plus
Dgri\GH15479-PA 770 GH15479-PA 133..295 18..174 206 33.1 Plus
Dgri\GH15479-PA 770 GH15479-PA 652..755 172..290 177 35.3 Plus
Dgri\GH24995-PA 242 GH24995-PA 124..227 172..290 173 35.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6845-PD 303 CG6845-PD 3..303 1..301 1601 100 Plus
CG6845-PC 672 CG6845-PC 3..176 1..174 846 97.7 Plus
CG6845-PC 672 CG6845-PC 541..672 170..301 758 100 Plus
CG6845-PE 334 CG6845-PE 203..334 170..301 758 100 Plus
CG32320-PD 767 CG32320-PD 100..259 18..174 211 33.1 Plus
CG32320-PD 767 CG32320-PD 636..751 179..286 156 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16754-PA 684 GI16754-PA 13..181 9..174 408 51.5 Plus
Dmoj\GI16754-PA 684 GI16754-PA 530..676 155..301 270 37.2 Plus
Dmoj\GI16755-PA 629 GI16755-PA 24..183 18..174 193 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14510-PA 257 GL14510-PA 121..249 171..299 304 45 Plus
Dper\GL14143-PA 253 GL14143-PA 117..245 171..299 303 45 Plus
Dper\GL16050-PA 273 GL16050-PA 141..267 171..301 276 42.7 Plus
Dper\GL22505-PA 770 GL22505-PA 83..230 18..174 227 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25497-PA 491 GA25497-PA 355..485 171..301 303 43.5 Plus
Dpse\GA16830-PA 664 GA16830-PA 456..539 201..277 171 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14310-PA 672 GM14310-PA 3..176 1..174 845 94.8 Plus
Dsec\GM14310-PA 672 GM14310-PA 541..672 170..301 673 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13546-PA 672 GD13546-PA 3..176 1..174 849 95.4 Plus
Dsim\GD13546-PA 672 GD13546-PA 541..672 170..301 685 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12498-PA 680 GJ12498-PA 13..181 9..174 390 54.4 Plus
Dvir\GJ12498-PA 680 GJ12498-PA 530..672 155..301 257 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21029-PA 258 GK21029-PA 14..177 9..169 445 55.6 Plus
Dwil\GK21036-PA 307 GK21036-PA 204..297 171..294 219 39.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21054-PA 672 GE21054-PA 3..176 1..174 779 85.6 Plus
Dyak\GE21054-PA 672 GE21054-PA 542..672 171..301 594 86.3 Plus
Dyak\GE21151-PA 475 GE21151-PA 359..464 160..262 172 38.3 Plus