Clone LD03471 Report

Search the DGRC for LD03471

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:34
Well:71
Vector:pBS SK-
Associated Gene/TranscriptSec13-RA
Protein status:LD03471.pep: gold
Preliminary Size:1513
Sequenced Size:1522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6773 2001-01-01 Release 2 assignment
CG6773 2002-12-11 Blastp of sequenced clone
CG6773 2003-01-01 Sim4 clustering to Release 3
sec13 2008-04-29 Release 5.5 accounting
sec13 2008-08-15 Release 5.9 accounting
sec13 2008-12-18 5.12 accounting

Clone Sequence Records

LD03471.complete Sequence

1522 bp (1522 high quality bases) assembled on 2002-12-11

GenBank Submission: AF160909

> LD03471.complete
CTCAACCAGGTTCCACGTCAAGCGCCGGAAAAAAACACGACTTGCATTTA
ATCAATTTATCTGGCGACCGGACGAACGGATTTCGAGCAAGATGGTGAGC
CTGCTGCAAGAGATCGACACCGAGCACGAGGACATGGTCCACCACGCAGC
GCTGGACTTCTACGGCCTACTGTTGGCCACCTGCTCCTCGGACGGCAGCG
TCCGCATCTTTCACTCGCGCAAAAACAATAAGGCGCTCGCCGAGCTCAAG
GGACACCAGGGACCAGTGTGGCAGGTGGCCTGGGCACATCCCAAGTTTGG
CAACATACTGGCATCGTGCTCCTACGACCGCAAGGTGATCGTCTGGAAGT
CCACAACGCCCCGGGATTGGACTAAGCTCTACGAATACAGCAACCACGAC
TCCTCGGTAAACTCGGTGGACTTCGCGCCATCCGAGTACGGATTGGTGTT
GGCCTGCGCCAGTTCGGATGGCTCGGTATCGGTGCTCACCTGCAACACGG
AGTACGGTGTGTGGGATGCCAAGAAGATACCGAATGCGCACACGATCGGA
GTGAATGCCATCTCGTGGTGCCCCGCCCAGGCACCAGATCCAGCATTTGA
CCAGCGCGTAACTTCGCGTTCGGCGGCCGTAAAGCGCCTAGTGAGCGGTG
GTTGCGATAATTTAGTGAAGATTTGGCGGGAGGACAACGACCGCTGGGTG
GAGGAGCACCGACTGGAGGCGCACTCGGATTGGGTGCGCGACGTGGCCTG
GGCGCCGTCGATCGGATTGCCCCGCTCGCAGATTGCCACGGCTTCGCAGG
ATCGCCATGTGATTGTGTGGAGCAGCAACGCAGATCTATCCGAGTGGACC
TCGACTGTGCTGCACACATTCGACGATGCCGTGTGGAGCATCTCGTGGTC
AACCACCGGCAACATTCTTGCCGTCACCGGTGGGGACAACAATGTCACAT
TGTGGAAGGAGAACACGGAGGGCCAATGGATCCGCATCAACTACGAGTCG
GGTACGGCCATCCAGTCGAAGCAGCCCTCGCACCTTCCGCATTCCCACTC
CCAGCAGCAGCAGGCGCTACAACAGCACCAACAACAGGCGCCATCGCATC
CAGGTCCTTCCTCCGATTCGGAGCATAGCTCGAACCTGTCCAACTCGCAG
CTCTCCAACTGAGCCAGCCCCGAAATATTGTCGTGCTGAAGTCGTGGTTA
AAAGTGTTACTTTACAAATATATATATACGAAATACTATTTAATGTGCCC
CTTTAAACGCTGTTTAGTGTATGTTTATTTGGACTTCATATGGGATCCCT
ATTTGAATCTTCTGAAATTATAATGAATTCTAAAGACAAGTTTTTGTCGA
AATGGTATCATTTTTTTTAAGTTTTATCAAATATATTTGCAAATTGTAAG
TAGTATGTATTTAAAAATAATAGTATAATAAGATTTAAATAATTAACCAA
ATTTTATTCAAACTTATTATTTTTAACCATACAGATAAATTCCAAAACTA
AAATTTTTACACAAAAAAAAAA

LD03471.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
sec13-RA 1611 sec13-RA 99..1611 1..1513 7565 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19180797..19181930 379..1512 5655 99.9 Plus
chr3R 27901430 chr3R 19179974..19180351 1..378 1890 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:50:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23357398..23358533 379..1514 5680 100 Plus
3R 32079331 3R 23356575..23356952 1..378 1890 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23098229..23099364 379..1514 5680 100 Plus
3R 31820162 3R 23097406..23097783 1..378 1890 100 Plus
Blast to na_te.dros performed 2019-03-16 07:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 2571..2698 1374..1490 154 65.1 Plus
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 678..772 1376..1470 141 63.5 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1123..1241 1476..1360 139 60.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6803 1020..1100 135 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6815 1013..1091 134 63.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2384 1013..1087 132 64 Plus
roo 9092 roo DM_ROO 9092bp 1043..1123 1014..1093 132 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2597..2665 1018..1086 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6782 1052..1100 128 73.5 Plus
Doc2-element 4789 Doc2-element DOC2 4789bp 4691..4730 1406..1445 128 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2499..2541 1052..1094 125 76.7 Plus
blood 7410 blood BLOOD 7410bp 6849..7001 1347..1497 121 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2396 1052..1102 120 70.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6778..6843 1018..1086 113 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6836 973..1091 112 58.1 Plus

LD03471.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:14 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19179974..19180351 1..378 100 -> Plus
chr3R 19180797..19181825 379..1407 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:32:43 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
sec13-RA 1..1071 92..1162 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:00:09 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
sec13-RA 1..1071 92..1162 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:28 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
Sec13-RA 1..1071 92..1162 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:44 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
sec13-RA 1..1071 92..1162 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:18 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
Sec13-RA 1..1071 92..1162 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:17:18 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
sec13-RA 8..1519 1..1512 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:00:09 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
sec13-RA 8..1519 1..1512 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:28 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
Sec13-RA 13..1343 1..1331 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:44 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
sec13-RA 8..1519 1..1512 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:18 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
Sec13-RB 298..1809 1..1512 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:14 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23356575..23356952 1..378 100 -> Plus
3R 23357398..23358531 379..1512 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:14 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23356575..23356952 1..378 100 -> Plus
3R 23357398..23358531 379..1512 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:14 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23356575..23356952 1..378 100 -> Plus
3R 23357398..23358531 379..1512 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:28 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19182297..19182674 1..378 100 -> Plus
arm_3R 19183120..19184253 379..1512 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:29 Download gff for LD03471.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23097406..23097783 1..378 100 -> Plus
3R 23098229..23099362 379..1512 100   Plus

LD03471.hyp Sequence

Translation from 0 to 1161

> LD03471.hyp
STRFHVKRRKKTRLAFNQFIWRPDERISSKMVSLLQEIDTEHEDMVHHAA
LDFYGLLLATCSSDGSVRIFHSRKNNKALAELKGHQGPVWQVAWAHPKFG
NILASCSYDRKVIVWKSTTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVL
ACASSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFD
QRVTSRSAAVKRLVSGGCDNLVKIWREDNDRWVEEHRLEAHSDWVRDVAW
APSIGLPRSQIATASQDRHVIVWSSNADLSEWTSTVLHTFDDAVWSISWS
TTGNILAVTGGDNNVTLWKENTEGQWIRINYESGTAIQSKQPSHLPHSHS
QQQQALQQHQQQAPSHPGPSSDSEHSSNLSNSQLSN*

LD03471.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sec13-PB 356 CG6773-PB 1..356 31..386 1920 100 Plus
Sec13-PA 356 CG6773-PA 1..356 31..386 1920 100 Plus
Nup44A-PA 354 CG8722-PA 4..307 35..326 357 27.7 Plus
Nup44A-PC 354 CG8722-PC 4..307 35..326 357 27.7 Plus
Nup44A-PB 354 CG8722-PB 4..307 35..326 357 27.7 Plus

LD03471.pep Sequence

Translation from 91 to 1161

> LD03471.pep
MVSLLQEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNKALA
ELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWKSTTPRDWTKLYEYS
NHDSSVNSVDFAPSEYGLVLACASSDGSVSVLTCNTEYGVWDAKKIPNAH
TIGVNAISWCPAQAPDPAFDQRVTSRSAAVKRLVSGGCDNLVKIWREDND
RWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVIVWSSNADLS
EWTSTVLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQWIRIN
YESGTAIQSKQPSHLPHSHSQQQQALQQHQQQAPSHPGPSSDSEHSSNLS
NSQLSN*

LD03471.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16993-PA 363 GF16993-PA 1..347 1..345 1644 92.8 Plus
Dana\GF13653-PA 354 GF13653-PA 4..307 5..296 335 27.7 Plus
Dana\GF20651-PA 698 GF20651-PA 420..660 25..297 189 28.5 Plus
Dana\GF12085-PA 335 GF12085-PA 10..238 52..311 177 28.1 Plus
Dana\GF11078-PA 704 GF11078-PA 427..645 32..288 166 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11201-PA 356 GG11201-PA 1..356 1..356 1871 99.2 Plus
Dere\GG23322-PA 354 GG23322-PA 4..307 5..296 333 27.4 Plus
Dere\GG24716-PA 700 GG24716-PA 422..662 25..297 187 28.5 Plus
Dere\GG22391-PA 335 GG22391-PA 10..222 52..289 167 26.7 Plus
Dere\GG22709-PA 704 GG22709-PA 427..645 32..288 164 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19595-PA 353 GH19595-PA 1..337 1..345 1619 88.4 Plus
Dgri\GH21895-PA 349 GH21895-PA 4..302 5..296 329 27.5 Plus
Dgri\GH11222-PA 766 GH11222-PA 488..724 25..292 180 27.5 Plus
Dgri\GH22988-PA 331 GH22988-PA 10..218 52..289 162 28.4 Plus
Dgri\GH20712-PA 706 GH20712-PA 429..647 32..288 162 27.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Sec13-PB 356 CG6773-PB 1..356 1..356 1920 100 Plus
Sec13-PA 356 CG6773-PA 1..356 1..356 1920 100 Plus
Nup44A-PA 354 CG8722-PA 4..307 5..296 357 27.7 Plus
Nup44A-PC 354 CG8722-PC 4..307 5..296 357 27.7 Plus
Nup44A-PB 354 CG8722-PB 4..307 5..296 357 27.7 Plus
ebi-PA 700 CG4063-PA 422..658 25..292 206 28.6 Plus
Ciao1-PA 335 CG12797-PA 10..222 52..289 200 27.4 Plus
Taf5-PA 704 CG7704-PA 427..645 32..288 180 27.1 Plus
Lis-1-PG 411 CG8440-PG 149..366 12..243 171 26.4 Plus
Lis-1-PF 411 CG8440-PF 149..366 12..243 171 26.4 Plus
Lis-1-PB 411 CG8440-PB 149..366 12..243 171 26.4 Plus
Lis-1-PA 411 CG8440-PA 149..366 12..243 171 26.4 Plus
CG3436-PC 347 CG3436-PC 54..305 12..292 168 23.4 Plus
CG3436-PA 347 CG3436-PA 54..305 12..292 168 23.4 Plus
Nle-PA 488 CG2863-PA 224..449 28..293 158 25.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\moj137-PA 354 GI23988-PA 1..315 1..315 1566 91.1 Plus
Dmoj\GI20394-PA 356 GI20394-PA 4..308 5..296 324 27.7 Plus
Dmoj\GI21646-PA 723 GI21646-PA 445..685 25..297 178 28.4 Plus
Dmoj\GI18956-PA 331 GI18956-PA 10..218 52..289 161 29 Plus
Dmoj\GI20797-PA 708 GI20797-PA 431..649 32..288 157 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13786-PA 358 GL13786-PA 1..317 1..317 1605 93.4 Plus
Dper\GL11480-PA 354 GL11480-PA 4..307 5..296 336 28.3 Plus
Dper\GL18875-PA 694 GL18875-PA 416..656 25..297 188 28.5 Plus
Dper\GL20028-PA 684 GL20028-PA 407..625 32..288 165 27.9 Plus
Dper\GL10827-PA 324 GL10827-PA 10..207 52..274 156 29.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19854-PA 356 GA19854-PA 1..317 1..317 1613 93.7 Plus
Dpse\GA21281-PA 354 GA21281-PA 4..307 5..296 333 28 Plus
Dpse\GA17928-PA 694 GA17928-PA 416..656 25..297 188 28.5 Plus
Dpse\GA11817-PA 335 GA11817-PA 10..238 52..311 172 28.1 Plus
Dpse\GA20529-PA 700 GA20529-PA 423..641 32..288 165 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26501-PA 356 GM26501-PA 1..356 1..356 1883 99.4 Plus
Dsec\GM20999-PA 354 GM20999-PA 4..307 5..296 339 27.7 Plus
Dsec\GM16739-PA 700 GM16739-PA 422..658 25..292 186 28.3 Plus
Dsec\GM20485-PA 704 GM20485-PA 427..645 32..288 173 28.3 Plus
Dsec\GM20174-PA 335 GM20174-PA 10..222 52..289 162 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21013-PA 356 GD21013-PA 1..356 1..356 1883 99.4 Plus
Dsim\GD10530-PA 354 GD10530-PA 4..307 5..296 338 27.7 Plus
Dsim\GD23022-PA 700 GD23022-PA 422..658 25..292 186 28.3 Plus
Dsim\GD25948-PA 704 GD25948-PA 427..645 32..288 172 28.3 Plus
Dsim\GD25651-PA 335 GD25651-PA 10..222 52..289 165 27.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23624-PA 352 GJ23624-PA 1..315 1..315 1602 93 Plus
Dvir\GJ22120-PA 354 GJ22120-PA 4..308 5..297 332 28.8 Plus
Dvir\GJ17774-PA 709 GJ17774-PA 431..671 25..297 182 27.8 Plus
Dvir\GJ21562-PA 331 GJ21562-PA 10..218 52..289 160 29 Plus
Dvir\GJ24581-PA 347 GJ24581-PA 54..311 12..302 159 24.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22486-PA 368 GK22486-PA 1..352 1..345 1582 88.4 Plus
Dwil\GK21742-PA 356 GK21742-PA 4..307 5..296 332 28.4 Plus
Dwil\GK22124-PA 335 GK22124-PA 10..238 52..311 163 27.4 Plus
Dwil\GK23911-PA 347 GK23911-PA 54..311 12..302 149 24 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10367-PA 357 GE10367-PA 1..357 1..356 1855 98.3 Plus
Dyak\GE19167-PA 354 GE19167-PA 4..307 5..296 339 27.4 Plus
Dyak\GE16791-PA 700 GE16791-PA 422..662 25..297 188 28.5 Plus
Dyak\GE12280-PA 335 GE12280-PA 10..222 52..289 166 27.4 Plus
Dyak\GE13065-PA 704 GE13065-PA 427..645 32..288 165 27.9 Plus