BDGP Sequence Production Resources |
Search the DGRC for LD03564
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 35 |
Well: | 64 |
Vector: | pBS SK- |
Associated Gene/Transcript | e(r)-RA |
Protein status: | LD03564.pep: gold |
Preliminary Size: | 1057 |
Sequenced Size: | 871 |
Gene | Date | Evidence |
---|---|---|
CG1871 | 2001-01-01 | Release 2 assignment |
CG1871 | 2002-07-13 | Blastp of sequenced clone |
CG1871 | 2003-01-01 | Sim4 clustering to Release 3 |
e(r) | 2008-04-29 | Release 5.5 accounting |
e(r) | 2008-08-15 | Release 5.9 accounting |
e(r) | 2008-12-18 | 5.12 accounting |
871 bp (871 high quality bases) assembled on 2002-07-13
GenBank Submission: BT001470
> LD03564.complete AAAACCCATAGAACTGGCAAAATAAAAAAAAACGAATCAAGCGCTGATTT TACCGAATCTCTTTACTGAATCAGCATATTATCATAGTCCATATAGTCCG GCGTTCGAACGGAGCTGGCGAAGTAAACTTCAACTTCGAGAGTCTCGGAA TCTTTCGGACTTTGCTATAGAAAAAACGCTTGTTAAAAAAAAGGATATCA CCATGTCGCACACCATCCTATTGGTACAGCCGGGTGCTCGTCCGGAGACC CGCACTTACTGTGACTACGAGAGCGTCAACGAGTGCATGGAGGGCGTGTG CAAGATCTACGAGGAGCACCTGAAGCGCCGCAATCCAAACACTCCGACCA TTACGTATGACATTAGCCAGCTATTCGATTTCATCGACACAATGGTGGAC ATTAGCTGCATGGTTTACCAGAAGAGCACCAATACCTATGCGCCCTACAA TAAGGATTGGATCAAGGAGAAGATCTATGTGCTGCTCCGTCAGGCGGCAT TTAGTTCCAATACCTAAAGGGACGGCGATGCGACAAGATACATACATATA AAACCAAATAACACGATGATGCATGCATCAATGCGTGCAACACTAACGAC AACAACACGTTGATGTATGCAACAATGCGTGCAATAGCAACTACAACAAC AACAACAATACGAGGATACATGCAACAGCGCTTGGAACAGCATCCGCAAC GGCCACAACACCATAACACCAATAACACCAACAAGATGAGGAAGAAGAAG AAGATGATGATGGAGTGGTGGGGCATCGATTCCATTGGAGACTTGCTGCT ACCGACTAGATCGCCAAATGACAGCAACTTTTTTTTGCAACATAACGCAA TGCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
e(r)-RA | 1066 | e(r)-RA | 81..939 | 1..859 | 4295 | 100 | Plus |
e(r).b | 1381 | e(r).b | 81..939 | 1..859 | 4295 | 100 | Plus |
e(r).c | 1297 | e(r).c | 193..855 | 197..859 | 3315 | 100 | Plus |
e(r).c | 1297 | e(r).c | 81..193 | 1..113 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 8796372..8797027 | 853..198 | 3250 | 99.7 | Minus |
chrX | 22417052 | chrX | 8797758..8797869 | 112..1 | 545 | 99.1 | Minus |
chrX | 22417052 | chrX | 8797153..8797237 | 196..112 | 410 | 98.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cr1a | 4470 | Cr1a DMCR1A 4470bp | 1420..1456 | 771..735 | 113 | 78.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 8796372..8796490 | 735..853 | 100 | == | Minus |
chrX | 8796594..8797028 | 197..631 | 99 | <- | Minus |
chrX | 8797153..8797236 | 113..196 | 98 | <- | Minus |
chrX | 8797758..8797869 | 1..112 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RB | 1..315 | 203..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RB | 1..315 | 203..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RC | 1..315 | 203..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RB | 1..315 | 203..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RC | 1..315 | 203..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RA | 25..877 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RA | 25..877 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RA | 29..881 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RA | 25..877 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
e(r)-RA | 29..881 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8905505..8905588 | 113..196 | 100 | <- | Minus |
X | 8906109..8906220 | 1..112 | 100 | Minus | |
X | 8904728..8905384 | 197..853 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8905505..8905588 | 113..196 | 100 | <- | Minus |
X | 8906109..8906220 | 1..112 | 100 | Minus | |
X | 8904728..8905384 | 197..853 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8905505..8905588 | 113..196 | 100 | <- | Minus |
X | 8906109..8906220 | 1..112 | 100 | Minus | |
X | 8904728..8905384 | 197..853 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 8798761..8799417 | 197..853 | 100 | <- | Minus |
arm_X | 8799538..8799621 | 113..196 | 100 | <- | Minus |
arm_X | 8800142..8800253 | 1..112 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 8912826..8913482 | 197..853 | 100 | <- | Minus |
X | 8913603..8913686 | 113..196 | 100 | <- | Minus |
X | 8914207..8914318 | 1..112 | 100 | Minus |
Translation from 202 to 516
> LD03564.pep MSHTILLVQPGARPETRTYCDYESVNECMEGVCKIYEEHLKRRNPNTPTI TYDISQLFDFIDTMVDISCMVYQKSTNTYAPYNKDWIKEKIYVLLRQAAF SSNT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19121-PA | 104 | GF19121-PA | 1..103 | 1..103 | 540 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19018-PA | 104 | GG19018-PA | 1..103 | 1..103 | 552 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12071-PA | 104 | GH12071-PA | 1..104 | 1..104 | 535 | 94.2 | Plus |
Dgri\GH22123-PA | 104 | GH22123-PA | 1..103 | 1..103 | 465 | 82.5 | Plus |
Dgri\GH11643-PA | 102 | GH11643-PA | 1..100 | 1..100 | 365 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
e(r)-PE | 104 | CG1871-PE | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PD | 104 | CG1871-PD | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PC | 104 | CG1871-PC | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PB | 104 | CG1871-PB | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PA | 104 | CG1871-PA | 1..104 | 1..104 | 560 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15564-PA | 104 | GI15564-PA | 1..104 | 1..104 | 544 | 95.2 | Plus |
Dmoj\GI17945-PA | 102 | GI17945-PA | 1..101 | 1..101 | 376 | 63.4 | Plus |
Dmoj\GI21527-PA | 104 | GI21527-PA | 1..94 | 1..95 | 220 | 41.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13030-PA | 104 | GL13030-PA | 1..104 | 1..104 | 541 | 95.2 | Plus |
Dper\GL16035-PA | 102 | GL16035-PA | 1..102 | 1..102 | 425 | 74.5 | Plus |
Dper\GL14279-PA | 102 | GL14279-PA | 1..102 | 1..102 | 418 | 73.5 | Plus |
Dper\GL20777-PA | 111 | GL20777-PA | 6..94 | 5..93 | 244 | 47.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15053-PA | 104 | GA15053-PA | 1..104 | 1..104 | 541 | 95.2 | Plus |
Dpse\GA25038-PA | 102 | GA25038-PA | 1..102 | 1..102 | 418 | 72.5 | Plus |
Dpse\GA26111-PA | 102 | GA26111-PA | 1..102 | 1..102 | 408 | 70.6 | Plus |
Dpse\GA28552-PA | 111 | GA28552-PA | 6..94 | 5..93 | 248 | 46.1 | Plus |
Dpse\GA28312-PA | 116 | GA28312-PA | 6..96 | 5..95 | 244 | 46.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13693-PA | 104 | GM13693-PA | 1..104 | 1..104 | 562 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15793-PA | 104 | GD15793-PA | 1..104 | 1..104 | 562 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\e(r)-PA | 104 | GJ15176-PA | 1..104 | 1..104 | 544 | 95.2 | Plus |
Dvir\GJ17717-PA | 103 | GJ17717-PA | 1..101 | 1..101 | 356 | 63.4 | Plus |
Dvir\GJ17487-PA | 102 | GJ17487-PA | 1..102 | 1..103 | 249 | 44.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16838-PA | 104 | GK16838-PA | 1..103 | 1..103 | 542 | 96.1 | Plus |
Dwil\GK15131-PA | 103 | GK15131-PA | 1..101 | 1..101 | 348 | 60.4 | Plus |
Dwil\GK15494-PA | 107 | GK15494-PA | 6..103 | 3..99 | 242 | 39.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17427-PA | 104 | GE17427-PA | 1..103 | 1..103 | 552 | 98.1 | Plus |
Translation from 202 to 516
> LD03564.hyp MSHTILLVQPGARPETRTYCDYESVNECMEGVCKIYEEHLKRRNPNTPTI TYDISQLFDFIDTMVDISCMVYQKSTNTYAPYNKDWIKEKIYVLLRQAAF SSNT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
e(r)-PE | 104 | CG1871-PE | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PD | 104 | CG1871-PD | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PC | 104 | CG1871-PC | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PB | 104 | CG1871-PB | 1..104 | 1..104 | 560 | 100 | Plus |
e(r)-PA | 104 | CG1871-PA | 1..104 | 1..104 | 560 | 100 | Plus |