Clone LD03592 Report

Search the DGRC for LD03592

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:35
Well:92
Vector:pBS SK-
Associated Gene/TranscriptSnap29-RA
Protein status:LD03592.pep: gold
Preliminary Size:1408
Sequenced Size:1206

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11173 2001-01-01 Release 2 assignment
CG11173 2001-10-10 Blastp of sequenced clone
CG11173 2003-01-01 Sim4 clustering to Release 3
usnp 2008-04-29 Release 5.5 accounting
usnp 2008-08-15 Release 5.9 accounting
usnp 2008-12-18 5.12 accounting

Clone Sequence Records

LD03592.complete Sequence

1206 bp (1206 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061069

> LD03592.complete
CAACAACAAAGAAAATAAAAGTTTACGAAAACATAACAAAATTCGACATT
TTGGAAGTTTCCCTCGCCACAAGAAATGGCCCATAACTACCTGCAGCCAG
TGCACGATCACTTCGATGACGTGGACAGATTCGAGGACGTGGACGACGAC
CTATTCCTGCAGAACAAACGGACGGGAGCAGCCAAGCTTCCGCAGCAGAG
GAGCACCAATCCCTTCGAGATGGATGACGATGACGAAGAGGAGATAACCT
CGTCGCCATCAGTGGCCGCACAGCGACTGGCCTATGCTGAGAAGCGAAGG
GCCATTGAGCAGCGAACTCTGGACTCTACCAACAAAAGCTTGGGTCTGCT
CTACGAAACCCAGGAGGTGGGTAAGGCGACGGCCGTGGAGCTGGCCAAGC
AGCGGGAGCAACTGGAGAAGACATCACATCAGTTGGACGAGATCAGCTCC
ACGCTGCGCTTCAGCCAGCGCCATCTGACTGGTCTGAAGAGTGTCTTCGG
CGGCCTCAAGAACTACCTTTCGGGCAACAGGGACCAACCACCCACCGCGA
CTGGTTCGCCCACGGGCAGTCAGTCCTCCCAGGAGGCCAATAGCAACATT
AACCAGGGTGCCTGTGGCGGTGCTAGCCCCTCGGCTCCGCTATCACCAGC
GGAGCGCTACGACAATCATCCGGTTAGCCAGCTGCGTGGTGATCCCAGCA
GCACCTACCAGCCCCAGCGACAGGCGGCCAATCCCTTCCAGGCCCAGATC
GATTCCAATCTGGAGGAGATGTGCAGCAACCTGTCGGTGCTGAAGATGCT
GGCCACCGATCTGGGTGGCGAAATTGAGTCGCAAAATGAATTGCTGGATA
ACATGAACTACAAAATTGAGGATGTCGACTTGAAGATTCACAAGCAGAAC
AAGGACATGAGCAAGCTTCTGAAGAAGTGAACAAGCGAGCATTCGCATAC
TATTGTATTGATCATTGCTTAGAATAGCCCTCCCTTAATATACAAATCTT
AGCCATACCATATCGCACGGTGAGCACTTCACAAGGCCATTAAGAATGCA
TTCCTCATTATGTTTCCTAGTTTTTTATTGTTACACACACCAAAACAATT
CTCTCAATGGAGTGCTCGTAGTTGGAGAGCGATAAGTGTTCAGTTTTAAA
TAAAGATTCATATAAAAAGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

LD03592.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
usnp-RA 1349 usnp-RA 130..1301 1..1172 5860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19729571..19730398 1170..343 4140 100 Minus
chr2R 21145070 chr2R 19730465..19730809 345..1 1725 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:50:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23843481..23844310 1172..343 4150 100 Minus
2R 25286936 2R 23844377..23844721 345..1 1725 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23844680..23845509 1172..343 4150 100 Minus
2R 25260384 2R 23845576..23845920 345..1 1725 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:05:27 has no hits.

LD03592.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:06:28 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19730467..19730809 1..343 100   Minus
chr2R 19729571..19730397 344..1170 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:33:05 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 1..855 76..930 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:47:19 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 1..855 76..930 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:59:33 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 1..855 76..930 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:06 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 1..855 76..930 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:18:48 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
Snap29-RA 1..855 76..930 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:31:05 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 5..1174 1..1170 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:47:18 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 5..1174 1..1170 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:59:33 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 43..1212 1..1170 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:06 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
usnp-RA 5..1174 1..1170 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:18:48 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
Snap29-RA 43..1212 1..1170 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:28 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23843483..23844309 344..1170 100 <- Minus
2R 23844379..23844721 1..343 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:28 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23843483..23844309 344..1170 100 <- Minus
2R 23844379..23844721 1..343 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:28 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23843483..23844309 344..1170 100 <- Minus
2R 23844379..23844721 1..343 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:59:33 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19731006..19731832 344..1170 100 <- Minus
arm_2R 19731902..19732244 1..343 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:52:56 Download gff for LD03592.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23844700..23845526 344..1170 100 <- Minus
2R 23845596..23845938 1..343 100   Minus

LD03592.pep Sequence

Translation from 75 to 929

> LD03592.pep
MAHNYLQPVHDHFDDVDRFEDVDDDLFLQNKRTGAAKLPQQRSTNPFEMD
DDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGK
ATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSG
NRDQPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPV
SQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEI
ESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLKK*

LD03592.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12455-PA 281 GF12455-PA 1..281 1..284 1156 81 Plus
Dana\GF23192-PA 212 GF23192-PA 27..211 81..283 157 26.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19992-PA 283 GG19992-PA 1..283 1..284 1463 97.5 Plus
Dere\GG17329-PA 212 GG17329-PA 27..211 81..283 159 26.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22912-PA 287 GH22912-PA 1..287 1..284 949 70.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Snap29-PA 284 CG11173-PA 1..284 1..284 1457 100 Plus
Snap24-PA 212 CG9474-PA 7..211 59..283 174 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18402-PA 283 GI18402-PA 1..283 1..284 1017 72.2 Plus
Dmoj\GI24884-PA 212 GI24884-PA 27..211 81..283 161 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11066-PA 280 GL11066-PA 1..280 1..284 1183 80.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10816-PA 280 GA10816-PA 1..280 1..284 1183 80.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15506-PA 284 GM15506-PA 1..284 1..284 1503 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25008-PA 284 GD25008-PA 1..284 1..284 1503 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21482-PA 280 GJ21482-PA 1..280 1..284 974 71.2 Plus
Dvir\GJ24526-PA 212 GJ24526-PA 27..211 81..283 153 26.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15806-PA 286 GK15806-PA 1..286 1..284 976 74 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11526-PA 284 GE11526-PA 1..284 1..284 1496 98.9 Plus
Dyak\GE24734-PA 212 GE24734-PA 6..211 58..283 161 26.1 Plus

LD03592.hyp Sequence

Translation from 75 to 929

> LD03592.hyp
MAHNYLQPVHDHFDDVDRFEDVDDDLFLQNKRTGAAKLPQQRSTNPFEMD
DDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGK
ATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSG
NRDQPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPV
SQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEI
ESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLKK*

LD03592.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Snap29-PA 284 CG11173-PA 1..284 1..284 1457 100 Plus
Snap24-PA 212 CG9474-PA 7..211 59..283 174 25.3 Plus