Clone LD03613 Report

Search the DGRC for LD03613

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:36
Well:13
Vector:pBS SK-
Associated Gene/TranscriptCG3719-RA
Protein status:LD03613.pep: gold
Preliminary Size:992
Sequenced Size:834

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3719 2001-01-01 Release 2 assignment
CG3719 2002-06-06 Blastp of sequenced clone
CG3719 2003-01-01 Sim4 clustering to Release 3
CG3719 2008-04-29 Release 5.5 accounting
CG3719 2008-08-15 Release 5.9 accounting
CG3719 2008-12-18 5.12 accounting

Clone Sequence Records

LD03613.complete Sequence

834 bp (834 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119573

> LD03613.complete
CGCATACACATCACGTACGGAACAACCAGTTGGACATCCGAGACCCTGCC
AGATATCTAATCGCTGCGAGAGTGCCTGTGTTACGCATCCGAATCCGCAT
ACCCATCCGCCCCCGTACTGAATTTCCGCAATCCGCAATGCTGAAGATCG
CCGCCGAGGGAATCGCGCCACGTCTGGCGGCGGCCTGTTGCTCCATTGGA
GCGAAGAGCAGAGGCCAAAGAATGGCGCCCCAGGCGGCCAGGGGCACCCA
GAAGTACCTGTCGCAGTCGCAGCACCTCCACAAAATGCTGGTCATCAAAG
ACCACTACGAGTTCGATCAGAAGGTGATCAACAGCGACAACCCGGTGATC
GTGAACTTCCACGCCGAGTGGTGCGACCCCTGTAAGATACTCACGCCCAA
GATGCTCGAGCTGCTTGAGAACTCGAACGAGATCGACCTGGCGGTCATCG
ATGTGGAGACGAACCTGGATCTCGTCGAGACCTTCGAGGTGAAGGCCGTG
CCCGCTGTTCTGGCCTTCAGGAACGGCGTCGTAGTGGACAAGTTCATTGG
TCTGGTCGACGCCAACAGCATCGAGACCCTAATCGACAAACTGAAGCGGA
AGCAACAGCAGAAGCAGTAGTGAGCTGGAGCGGCGATGCGATGCACAGGT
GGATTAGATCAGGGATGCTATGATTTTACACACGAAACGGGAGACTGGAA
CTGCGATATGAAGCCCAATGCCGAGGCAGAATTTGCAATCATCGATGCTG
AAAGAATGTGCACAACATACCTTAATATGCAATAAAACTAACTTTAATTA
TGGCTACTCTTAAAAAAAAAAAAAAAAAAAAAAA

LD03613.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3719-RA 1308 CG3719-RA 281..1093 1..813 4065 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1272819..1273308 811..322 2450 100 Minus
chrX 22417052 chrX 1274068..1274394 327..1 1635 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:50:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1378883..1379374 813..322 2460 100 Minus
X 23542271 X 1380134..1380460 327..1 1635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1386981..1387472 813..322 2460 100 Minus
X 23527363 X 1388232..1388558 327..1 1635 100 Minus
Blast to na_te.dros performed 2019-03-15 22:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6836 563..634 119 66.2 Plus

LD03613.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:02:49 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1272819..1273306 324..811 100 <- Minus
chrX 1274072..1274394 1..323 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:33:09 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 1..483 138..620 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:13 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 1..483 138..620 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:06:20 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 1..483 138..620 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:17 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 1..483 138..620 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:09:57 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 1..483 138..620 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:01:13 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 17..827 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:13 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 17..827 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:06:20 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 21..831 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:17 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 17..827 1..811 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:09:57 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
CG3719-RA 21..831 1..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:02:49 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
X 1380138..1380460 1..323 100   Minus
X 1378885..1379372 324..811 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:02:49 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
X 1380138..1380460 1..323 100   Minus
X 1378885..1379372 324..811 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:02:49 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
X 1380138..1380460 1..323 100   Minus
X 1378885..1379372 324..811 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:06:20 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1272918..1273405 324..811 100 <- Minus
arm_X 1274171..1274493 1..323 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:09 Download gff for LD03613.complete
Subject Subject Range Query Range Percent Splice Strand
X 1388236..1388558 1..323 100   Minus
X 1386983..1387470 324..811 100 <- Minus

LD03613.hyp Sequence

Translation from 2 to 619

> LD03613.hyp
HTHHVRNNQLDIRDPARYLIAARVPVLRIRIRIPIRPRTEFPQSAMLKIA
AEGIAPRLAAACCSIGAKSRGQRMAPQAARGTQKYLSQSQHLHKMLVIKD
HYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDLAVID
VETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDKLKRK
QQQKQ*

LD03613.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3719-PA 160 CG3719-PA 1..160 46..205 814 100 Plus
CG8993-PA 142 CG8993-PA 17..134 79..194 208 36.4 Plus
CG8517-PA 145 CG8517-PA 34..133 98..196 195 35 Plus
TrxT-PB 157 CG3315-PB 5..104 98..196 150 28.7 Plus
TrxT-PA 157 CG3315-PA 5..104 98..196 150 28.7 Plus

LD03613.pep Sequence

Translation from 137 to 619

> LD03613.pep
MLKIAAEGIAPRLAAACCSIGAKSRGQRMAPQAARGTQKYLSQSQHLHKM
LVIKDHYEFDQKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEID
LAVIDVETNLDLVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLID
KLKRKQQQKQ*

LD03613.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21263-PA 162 GF21263-PA 1..152 1..150 691 88.9 Plus
Dana\GF24914-PA 143 GF24914-PA 19..134 26..149 212 34.4 Plus
Dana\GF11737-PA 138 GF11737-PA 37..132 58..152 196 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12702-PA 159 GG12702-PA 1..159 1..160 817 98.1 Plus
Dere\GG21998-PA 145 GG21998-PA 39..133 58..151 200 36.8 Plus
Dere\GG14861-PA 142 GG14861-PA 23..134 39..149 183 35.7 Plus
Dere\TrxT-PA 149 GG18503-PA 2..92 50..138 140 29.7 Plus
Dere\GG15694-PA 135 GG15694-PA 4..123 47..159 138 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12588-PA 161 GH12588-PA 1..161 1..160 717 87.7 Plus
Dgri\GH16478-PA 140 GH16478-PA 18..131 37..149 201 33.3 Plus
Dgri\GH23019-PA 153 GH23019-PA 45..140 58..152 173 32.3 Plus
Dgri\GH14756-PA 133 GH14756-PA 13..104 49..138 137 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3719-PA 160 CG3719-PA 1..160 1..160 814 100 Plus
CG8993-PA 142 CG8993-PA 17..134 34..149 208 36.4 Plus
CG8517-PA 145 CG8517-PA 34..133 53..151 195 35 Plus
TrxT-PB 157 CG3315-PB 5..104 53..151 150 28.7 Plus
TrxT-PA 157 CG3315-PA 5..104 53..151 150 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16217-PA 138 GI16217-PA 1..82 1..81 334 81.9 Plus
Dmoj\GI21084-PA 144 GI21084-PA 31..128 53..149 161 31.6 Plus
Dmoj\GI11498-PA 162 GI11498-PA 13..104 49..138 145 30.4 Plus
Dmoj\Trx-2-PA 106 GI11084-PA 5..92 53..138 137 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14382-PA 161 GL14382-PA 1..151 1..150 704 89.4 Plus
Dper\GL24652-PA 143 GL24652-PA 19..134 26..149 219 35.2 Plus
Dper\TrxT-PA 167 GL14330-PA 2..92 50..138 146 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17639-PA 161 GA17639-PA 1..151 1..150 704 89.4 Plus
Dpse\GA21460-PA 143 GA21460-PA 18..134 25..149 226 35.7 Plus
Dpse\TrxT-PA 167 GA17324-PA 2..92 50..138 146 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18978-PA 72 GM18978-PA 1..72 89..160 357 100 Plus
Dsec\GM21982-PA 145 GM21982-PA 34..121 53..139 197 38.6 Plus
Dsec\GM23203-PA 145 GM23203-PA 34..121 53..139 197 38.6 Plus
Dsec\GM14486-PA 142 GM14486-PA 23..134 39..149 183 35.7 Plus
Dsec\Trx-2-PA 106 GM17580-PA 5..102 53..149 134 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16424-PA 159 GD16424-PA 1..159 1..160 817 98.1 Plus
Dsim\GD11480-PA 145 GD11480-PA 34..121 53..139 197 38.6 Plus
Dsim\GD13682-PA 142 GD13682-PA 23..134 39..149 183 35.7 Plus
Dsim\Trx-2-PA 106 GD23618-PA 5..102 53..149 134 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15909-PA 161 GJ15909-PA 1..161 1..160 720 87.7 Plus
Dvir\GJ13429-PA 141 GJ13429-PA 17..132 35..149 213 34.5 Plus
Dvir\GJ20933-PA 105 GJ20933-PA 3..98 58..152 190 36.5 Plus
Dvir\GJ13693-PA 162 GJ13693-PA 13..125 49..160 150 29.8 Plus
Dvir\Trx-2-PA 106 GJ18315-PA 5..105 53..152 138 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16685-PA 161 GK16685-PA 1..151 1..150 607 81.5 Plus
Dwil\GK15891-PA 145 GK15891-PA 40..134 58..154 204 37.8 Plus
Dwil\GK12639-PA 141 GK12639-PA 21..132 39..149 202 33.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16531-PA 159 GE16531-PA 1..159 1..160 807 96.9 Plus
Dyak\GE12078-PA 145 GE12078-PA 34..133 53..151 199 35 Plus
Dyak\GE20317-PA 142 GE20317-PA 23..134 39..149 182 35.7 Plus
Dyak\TrxT-PA 157 GE16820-PA 23..92 70..138 138 35.7 Plus