Clone LD03714 Report

Search the DGRC for LD03714

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:37
Well:14
Vector:pBS SK-
Associated Gene/TranscriptU2af50-RA
Protein status:LD03714.pep: gold
Preliminary Size:1558
Sequenced Size:1455

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9998 2001-01-01 Release 2 assignment
CG9998 2001-11-09 Blastp of sequenced clone
CG9998 2003-01-01 Sim4 clustering to Release 3
U2af50 2008-04-29 Release 5.5 accounting
U2af50 2008-08-15 Release 5.9 accounting
U2af50 2008-12-18 5.12 accounting

Clone Sequence Records

LD03714.complete Sequence

1455 bp (1455 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069320

> LD03714.complete
TTTTTTAAGTCGTTTCTTTTATATTTGCGTTAATATACGCAATAGAGGGA
CACATTTTTCTTCGGCATTTTAAAGAGTTAAAATTGTTTTCGTGTTAAGA
AATATTAATTTTATTTAGCAACAAGAATGGGATATGATGACCGTGAACGC
GATCGCGAGAGACGCCGACATCGTTCCCGCTCTCGGGACCGCCATCGCGA
ACGCTCCAGGGATCGACGCCATCACCGGAACTCGAGGCGCAAGCCGTCGC
TTTATTGGGATGTACCGCCGCCGGGATTCGAGCACATCACCCCGATGCAA
TACAAAGCCATGCAGGCGTCCGGACAAATCCCGGCAAGCGTTGTGCCGGA
TACACCACAAACGGCAGTGCCCGTGGTCGGATCGACAATTACCCGACAGG
CGCGTCGCCTGTACGTTGGCAACATTCCGTTTGGCGTCACCGAGGAGGAA
ATGATGGAGTTCTTCAACCAACAGATGCATTTAGTTGGGCTCGCCCAGGC
GGCCGGCAGTCCCGTCTTGGCATGCCAAATTAACTTGGACAAAAACTTTG
CTTTCCTCGAATTCCGATCGATTGATGAAACCACCCAGGCCATGGCATTC
GATGGCATCAATTTGAAGGGGCAGAGCTTAAAGATTAGGCGTCCGCACGA
TTACCAGCCCATGCCGGGTATAACAGATACGCCGGCAATTAAGCCCGCTG
TTGTTTCCAGTGGAGTTATTTCGACAGTGGTTCCGGACTCGCCTCACAAA
ATCTTCATCGGAGGTCTACCAAACTATCTGAATGACGATCAGGTTAAGGA
ACTGCTTTTGTCGTTTGGCAAGCTACGAGCCTTCAACCTGGTTAAGGATG
CCGCTACTGGGTTGAGTAAGGGTTATGCTTTCTGTGAATATGTCGATCTT
AGCATCACAGATCAGTCGATTGCTGGCCTAAATGGAATGCAGCTGGGTGA
CAAAAAACTGATTGTCCAACGAGCCAGTGTGGGCGCCAAGAATGCCCAGA
ACGCGGCCAACACCACGCAGTCCGTAATGCTCCAAGTGCCGGGCCTGTCC
AATGTGGTGACCTCTGGACCGCCGACTGAGGTTCTTTGCTTGCTCAACAT
GGTCACGCCCGATGAACTGCGGGACGAGGAGGAGTACGAGGACATCTTGG
AGGACATCAAGGAGGAGTGCACGAAATACGGAGTCGTGCGGAGCGTGGAA
ATTCCACGTCCCATCGAGGGCGTCGAAGTTCCCGGTTGCGGCAAGGTCTT
TGTCGAATTCAACTCGGTTCTCGACTGTCAGAAGGCGCAGCAAGCACTTA
CTGGACGTAAATTCAGCGACCGCGTTGTGGTCACATCATATTTCGATCCC
GACAAATACCACAGACGCGAGTTTTAGATACAAGTAAATCATATATCTCA
CATTCACCATTTGTCCAATAAATATCAGAATAAAAGTAAAAAAAAAAAAA
AAAAA

LD03714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
U2af50-RA 1749 U2af50-RA 119..1559 1..1441 7205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16247364..16247928 703..139 2810 99.8 Minus
chrX 22417052 chrX 16246417..16246940 1437..914 2620 100 Minus
chrX 22417052 chrX 16248533..16248671 139..1 695 100 Minus
chrX 22417052 chrX 16247016..16247140 915..791 625 100 Minus
chrX 22417052 chrX 16247202..16247294 795..703 465 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:50:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16357643..16358207 703..139 2825 100 Minus
X 23542271 X 16356692..16357219 1441..914 2640 100 Minus
X 23542271 X 16358811..16358949 139..1 695 100 Minus
X 23542271 X 16357295..16357419 915..791 625 100 Minus
X 23542271 X 16357481..16357573 795..703 465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16365741..16366305 703..139 2825 100 Minus
X 23527363 X 16364790..16365317 1441..914 2640 100 Minus
X 23527363 X 16366909..16367047 139..1 695 100 Minus
X 23527363 X 16365393..16365517 915..791 625 100 Minus
X 23527363 X 16365579..16365671 795..703 465 100 Minus
Blast to na_te.dros performed 2019-03-16 02:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Tc3 1743 Tc3 TC3 1743bp 359..420 55..116 139 69.4 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1064..1122 67..127 120 68.9 Plus

LD03714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:04:01 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16247016..16247138 793..915 100 <- Minus
chrX 16247205..16247293 704..792 100 <- Minus
chrX 16246417..16246938 916..1437 100 <- Minus
chrX 16247364..16247927 140..703 99 <- Minus
chrX 16248533..16248671 1..139 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:33:27 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 1..1251 127..1377 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:29:07 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 1..1251 127..1377 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:39 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 1..1251 127..1377 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:56:43 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 1..1251 127..1377 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:56:54 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 1..1251 127..1377 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:06:33 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 91..1527 1..1437 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:29:07 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 91..1527 1..1437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:39 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 91..1527 1..1437 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:56:43 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 91..1527 1..1437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:56:54 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
U2af50-RA 91..1527 1..1437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:04:01 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
X 16356696..16357217 916..1437 100 <- Minus
X 16357295..16357417 793..915 100 <- Minus
X 16357484..16357572 704..792 100 <- Minus
X 16357643..16358206 140..703 100 <- Minus
X 16358811..16358949 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:04:01 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
X 16356696..16357217 916..1437 100 <- Minus
X 16357295..16357417 793..915 100 <- Minus
X 16357484..16357572 704..792 100 <- Minus
X 16357643..16358206 140..703 100 <- Minus
X 16358811..16358949 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:04:01 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
X 16356696..16357217 916..1437 100 <- Minus
X 16357295..16357417 793..915 100 <- Minus
X 16357484..16357572 704..792 100 <- Minus
X 16357643..16358206 140..703 100 <- Minus
X 16358811..16358949 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:39 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16251517..16251605 704..792 100 <- Minus
arm_X 16250729..16251250 916..1437 100 <- Minus
arm_X 16251328..16251450 793..915 100 <- Minus
arm_X 16251676..16252239 140..703 100 <- Minus
arm_X 16252844..16252982 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:32:55 Download gff for LD03714.complete
Subject Subject Range Query Range Percent Splice Strand
X 16364794..16365315 916..1437 100 <- Minus
X 16365393..16365515 793..915 100 <- Minus
X 16365582..16365670 704..792 100 <- Minus
X 16365741..16366304 140..703 100 <- Minus
X 16366909..16367047 1..139 100   Minus

LD03714.pep Sequence

Translation from 126 to 1376

> LD03714.pep
MGYDDRERDRERRRHRSRSRDRHRERSRDRRHHRNSRRKPSLYWDVPPPG
FEHITPMQYKAMQASGQIPASVVPDTPQTAVPVVGSTITRQARRLYVGNI
PFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSID
ETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVIST
VVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGY
AFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSV
MLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTK
YGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRV
VVTSYFDPDKYHRREF*

LD03714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19596-PA 416 GF19596-PA 1..416 1..416 2224 99.5 Plus
Dana\GF13310-PA 434 GF13310-PA 8..433 2..416 1183 58.2 Plus
Dana\GF14957-PA 594 GF14957-PA 188..572 22..412 180 22.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19328-PA 416 GG19328-PA 1..416 1..416 2229 99.8 Plus
Dere\GG20057-PA 440 GG20057-PA 44..434 31..411 1151 56.7 Plus
Dere\GG10454-PA 593 GG10454-PA 216..571 69..412 170 21.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12033-PA 416 GH12033-PA 1..416 1..416 2201 98.1 Plus
Dgri\GH23055-PA 453 GH23055-PA 73..452 38..416 1161 58.8 Plus
Dgri\GH13506-PA 628 GH13506-PA 251..606 69..412 172 20.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
U2af50-PD 416 CG9998-PD 1..416 1..416 2163 100 Plus
U2af50-PA 416 CG9998-PA 1..416 1..416 2163 100 Plus
U2af50-PB 427 CG9998-PB 16..427 5..416 2139 100 Plus
U2af50-PC 360 CG9998-PC 1..360 57..416 1846 100 Plus
LS2-PA 449 CG3162-PA 15..443 6..411 1129 55.1 Plus
Caper-PB 594 CG11266-PB 167..572 5..412 223 23.1 Plus
Caper-PA 594 CG11266-PA 167..572 5..412 223 23.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14308-PA 416 GI14308-PA 1..416 1..416 2201 98.1 Plus
Dmoj\GI21125-PA 427 GI21125-PA 52..426 44..416 1212 60.9 Plus
Dmoj\GI10246-PA 617 GI10246-PA 257..595 90..412 177 20.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15893-PA 418 GL15893-PA 1..418 1..416 2191 97.8 Plus
Dper\GL11290-PA 487 GL11290-PA 67..487 37..416 1063 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22177-PA 418 GA22177-PA 1..418 1..416 2191 97.8 Plus
Dpse\GA16338-PA 491 GA16338-PA 71..491 37..416 1073 53.4 Plus
Dpse\GA10876-PA 625 GA10876-PA 264..602 90..412 162 21.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13406-PA 416 GM13406-PA 1..416 1..416 2232 100 Plus
Dsec\GM15574-PA 445 GM15574-PA 53..439 39..411 1074 56.4 Plus
Dsec\GM16278-PA 596 GM16278-PA 236..574 90..412 176 21.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24494-PA 416 GD24494-PA 1..416 1..416 2232 100 Plus
Dsim\GD25073-PA 445 GD25073-PA 53..439 39..411 1086 56.8 Plus
Dsim\GD23448-PA 608 GD23448-PA 248..586 90..412 178 21.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19364-PA 476 GJ19364-PA 35..476 35..416 1877 82.8 Plus
Dvir\GJ20975-PA 428 GJ20975-PA 52..427 44..416 1220 60.5 Plus
Dvir\GJ18017-PA 599 GJ18017-PA 239..577 90..412 165 20.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10063-PA 416 GK10063-PA 1..416 1..416 2212 98.8 Plus
Dwil\GK19586-PA 466 GK19586-PA 79..466 37..416 1200 58.6 Plus
Dwil\GK15272-PA 612 GK15272-PA 252..590 90..412 165 21.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15975-PA 416 GE15975-PA 1..416 1..416 2232 100 Plus
Dyak\GE11595-PA 437 GE11595-PA 41..431 31..411 1196 58.4 Plus

LD03714.hyp Sequence

Translation from 126 to 1376

> LD03714.hyp
MGYDDRERDRERRRHRSRSRDRHRERSRDRRHHRNSRRKPSLYWDVPPPG
FEHITPMQYKAMQASGQIPASVVPDTPQTAVPVVGSTITRQARRLYVGNI
PFGVTEEEMMEFFNQQMHLVGLAQAAGSPVLACQINLDKNFAFLEFRSID
ETTQAMAFDGINLKGQSLKIRRPHDYQPMPGITDTPAIKPAVVSSGVIST
VVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVKDAATGLSKGY
AFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSV
MLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTK
YGVVRSVEIPRPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRV
VVTSYFDPDKYHRREF*

LD03714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
U2af50-PD 416 CG9998-PD 1..416 1..416 2163 100 Plus
U2af50-PA 416 CG9998-PA 1..416 1..416 2163 100 Plus
U2af50-PB 427 CG9998-PB 16..427 5..416 2139 100 Plus
U2af50-PC 360 CG9998-PC 1..360 57..416 1846 100 Plus
LS2-PA 449 CG3162-PA 15..443 6..411 1129 55.1 Plus