Clone LD04689 Report

Search the DGRC for LD04689

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:46
Well:89
Vector:pBS SK-
Associated Gene/TranscriptFer3-RA
Protein status:LD04689.pep: gold
Preliminary Size:998
Sequenced Size:822

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6913 2001-01-01 Release 2 assignment
CG6913 2002-03-19 Blastp of sequenced clone
CG6913 2003-01-01 Sim4 clustering to Release 3
Fer3 2008-04-29 Release 5.5 accounting
Fer3 2008-08-15 Release 5.9 accounting
Fer3 2008-12-18 5.12 accounting

Clone Sequence Records

LD04689.complete Sequence

822 bp (822 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094777

> LD04689.complete
AACAGACCCAAGGTCTTCCAATTGCAGTATCATCCAATACAATAGACAGT
CATGCAGCATCCACATCCCATTGACCAGCCCACCTACATGCCGGATGTTC
CATTCCAGCCGCTTTGGGGTCAGGAGGCTCCACCGCCGCCCATTGTTCCA
TACCAAGAGCTCATCGCCGGTTTTCCCTGCACCGACTTGTCTCTGTGGCA
GCGCTCGCAAGTAACTCCTTTGGTGCCCCAGCGTCCGTCGACAAATGGGA
GGGCCAACGGCTCCTCCAGCTCCTCGAAGAAAACGCGTCGCCGTGTGGCA
TCAATGGCCCAACGGAGAGCTGCAAATATCCGCGAACGCCGTCGCATGTT
TAACCTAAACGAGGCCTTCGACAAGTTGCGCCGCAAGGTGCCCACCTTCG
CCTACGAGAAACGACTGTCCCGCATCGAAACCCTTCGCTTGGCCATCACC
TACATCGGATTCATGGCTGAGCTGCTGAGCGGCACGCCCTCGAACTCCCA
CAAATCGCGGTCCGACGTCTATGGGAGTATGAATGGTCACCATCAGGCGC
CACCACCGGCAATTCATCCACATCATCTGCATCCGGCGGCGGCATATCAA
CGCGATTTCGCTTCGCCCTATAATCATAGTTTGTCCTAGTGACATTTCTC
AGGAAATCCAATATTCAAATAAATGCTAAAACTGCTTCTCGTCAGATCAG
TTTTGTTAAAATATTGTAATTATAGGAATAGATAAATAATGTTTTCTTAA
AACTTTATATATTGTTTAAAAAGCAATAGAAATATTAAAAAATATTAAAA
AGAAAAAAAAAAAAAAAAAAAA

LD04689.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3.a 1035 Fer3.a 234..1035 1..802 4010 100 Plus
Fer3-RA 1153 Fer3-RA 352..1153 1..802 4010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7518942..7519553 802..191 3045 99.8 Minus
chr3R 27901430 chr3R 7519620..7519809 190..1 935 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11693403..11694021 809..191 3080 99.8 Minus
3R 32079331 3R 11694088..11694277 190..1 950 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11434234..11434852 809..191 3080 99.8 Minus
3R 31820162 3R 11434919..11435108 190..1 950 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:51:44 has no hits.

LD04689.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:52:42 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7518971..7519553 191..773 99 <- Minus
chr3R 7519620..7519809 1..190 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:35:12 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..588 52..639 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:29:07 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..588 52..639 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:49 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..588 52..639 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:03:18 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..588 52..639 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:46 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..588 52..639 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:55:32 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:29:07 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:49 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 35..836 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:03:18 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:46 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 35..836 1..802 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:42 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11693410..11694021 191..802 100 <- Minus
3R 11694088..11694277 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:42 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11693410..11694021 191..802 100 <- Minus
3R 11694088..11694277 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:42 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11693410..11694021 191..802 100 <- Minus
3R 11694088..11694277 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:49 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7519132..7519743 191..802 100 <- Minus
arm_3R 7519810..7519999 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:36:48 Download gff for LD04689.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11434241..11434852 191..802 100 <- Minus
3R 11434919..11435108 1..190 100   Minus

LD04689.pep Sequence

Translation from 51 to 638

> LD04689.pep
MQHPHPIDQPTYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQ
RSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMF
NLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSH
KSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASPYNHSLS*

LD04689.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16621-PA 195 GF16621-PA 1..195 1..195 856 92.3 Plus
Dana\GF17655-PA 251 GF17655-PA 55..137 69..142 199 51.8 Plus
Dana\GF18852-PA 278 GF18852-PA 147..208 87..142 179 58.1 Plus
Dana\GF14839-PA 199 GF14839-PA 141..196 88..143 169 58.9 Plus
Dana\GF18335-PA 310 GF18335-PA 237..309 74..142 160 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17199-PA 195 GG17199-PA 1..195 1..195 1022 99 Plus
Dere\GG13863-PA 251 GG13863-PA 55..137 69..142 200 51.8 Plus
Dere\GG20146-PA 279 GG20146-PA 148..209 87..142 179 58.1 Plus
Dere\GG21703-PA 196 GG21703-PA 138..193 88..143 166 58.9 Plus
Dere\GG24254-PA 315 GG24254-PA 239..314 71..142 162 46.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19315-PA 197 GH19315-PA 3..197 5..195 755 83.2 Plus
Dgri\GH19006-PA 262 GH19006-PA 55..159 69..169 200 43.6 Plus
Dgri\GH18836-PA 283 GH18836-PA 152..213 87..142 173 56.5 Plus
Dgri\GH10530-PA 214 GH10530-PA 156..211 88..143 166 58.9 Plus
Dgri\GH18671-PA 326 GH18671-PA 250..325 71..142 161 46.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-PA 195 CG6913-PA 1..195 1..195 1045 100 Plus
Fer1-PA 251 CG33323-PA 55..159 69..169 198 41.8 Plus
Fer1-PB 256 CG33323-PB 69..164 71..169 197 44.6 Plus
Fer2-PE 273 CG5952-PE 122..204 63..142 177 50.6 Plus
Fer2-PB 274 CG5952-PB 122..204 63..142 177 50.6 Plus
Fer2-PC 279 CG5952-PC 122..209 63..142 171 47.7 Plus
amos-PA 198 CG10393-PA 116..195 63..143 170 50.6 Plus
Fer2-PD 283 CG5952-PD 122..213 63..142 168 45.7 Plus
ato-PA 312 CG7508-PA 231..311 65..142 157 42 Plus
HLH4C-PB 191 CG3052-PB 65..170 24..149 146 35.7 Plus
cato-PA 189 CG7760-PA 66..160 50..143 144 36.8 Plus
HLH4C-PA 167 CG3052-PA 65..164 24..142 142 35.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23534-PA 187 GI23534-PA 1..187 13..193 778 84 Plus
Dmoj\GI23536-PA 199 GI23536-PA 3..199 5..195 726 82.7 Plus
Dmoj\GI23061-PA 278 GI23061-PA 55..159 69..169 198 43.6 Plus
Dmoj\GI10095-PA 281 GI10095-PA 150..211 87..142 175 56.5 Plus
Dmoj\GI17198-PA 217 GI17198-PA 159..214 88..143 164 57.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12254-PA 190 GL12254-PA 1..190 1..195 585 69.4 Plus
Dper\GL12422-PA 253 GL12422-PA 55..137 69..142 200 51.8 Plus
Dper\GL12402-PA 284 GL12402-PA 153..214 87..142 178 58.1 Plus
Dper\GL23421-PA 327 GL23421-PA 249..326 68..142 176 44.9 Plus
Dper\GL18743-PA 206 GL18743-PA 142..203 83..143 172 56.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19952-PA 205 GA19952-PA 1..205 1..195 823 87.3 Plus
Dpse\GA27498-PA 253 GA27498-PA 55..137 69..142 200 51.8 Plus
Dpse\GA19254-PA 284 GA19254-PA 153..214 87..142 178 58.1 Plus
Dpse\ato-PA 330 GA20401-PA 252..329 68..142 176 44.9 Plus
Dpse\GA10296-PA 206 GA10296-PA 142..203 83..143 172 56.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26078-PA 245 GM26078-PA 51..245 1..195 1033 99.5 Plus
Dsec\GM10936-PA 247 GM10936-PA 55..137 69..142 199 51.8 Plus
Dsec\GM25729-PA 279 GM25729-PA 148..209 87..142 179 58.1 Plus
Dsec\GM17083-PA 197 GM17083-PA 139..194 88..143 165 58.9 Plus
Dsec\GM23715-PA 312 GM23715-PA 233..311 69..142 164 45.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20641-PA 195 GD20641-PA 1..195 1..195 1027 99.5 Plus
Dsim\GD19915-PA 251 GD19915-PA 55..137 69..142 200 51.8 Plus
Dsim\GD20306-PA 279 GD20306-PA 148..209 87..142 179 58.1 Plus
Dsim\GD21828-PA 197 GD21828-PA 139..194 88..143 165 58.9 Plus
Dsim\GD18530-PA 284 GD18530-PA 223..283 82..142 158 50.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10284-PA 198 GJ10284-PA 3..198 5..195 778 83.7 Plus
Dvir\GJ24574-PA 261 GJ24574-PA 55..137 69..142 199 51.8 Plus
Dvir\GJ23831-PA 278 GJ23831-PA 147..208 87..142 173 56.5 Plus
Dvir\GJ19805-PA 201 GJ19805-PA 143..198 88..143 165 58.9 Plus
Dvir\ato-PA 325 GJ10529-PA 243..324 66..142 165 43.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11993-PA 198 GK11993-PA 3..198 5..195 800 89.8 Plus
Dwil\GK14521-PA 247 GK14521-PA 56..138 69..142 197 51.8 Plus
Dwil\GK24655-PA 198 GK24655-PA 140..195 88..143 168 58.9 Plus
Dwil\GK14012-PA 285 GK14012-PA 145..215 70..142 168 48.1 Plus
Dwil\GK11390-PA 331 GK11390-PA 270..330 82..142 158 50.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10092-PA 226 GE10092-PA 32..226 1..195 1032 99 Plus
Dyak\GE24907-PA 251 GE24907-PA 55..137 69..142 200 51.8 Plus
Dyak\GE26333-PA 279 GE26333-PA 148..209 87..142 179 58.1 Plus
Dyak\GE12726-PA 198 GE12726-PA 140..195 88..143 166 58.9 Plus
Dyak\GE25860-PA 313 GE25860-PA 237..312 71..142 162 46.1 Plus

LD04689.hyp Sequence

Translation from 51 to 638

> LD04689.hyp
MQHPHPIDQPTYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQ
RSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMF
NLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSH
KSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASPYNHSLS*

LD04689.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-PA 195 CG6913-PA 1..195 1..195 1045 100 Plus
Fer1-PA 251 CG33323-PA 55..159 69..169 198 41.8 Plus
Fer1-PB 256 CG33323-PB 69..164 71..169 197 44.6 Plus
Fer2-PE 273 CG5952-PE 122..204 63..142 177 50.6 Plus
Fer2-PB 274 CG5952-PB 122..204 63..142 177 50.6 Plus