Clone LD05256 Report

Search the DGRC for LD05256

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:52
Well:56
Vector:pBS SK-
Associated Gene/TranscriptSP2637-RA
Protein status:LD05256.pep: gold
Preliminary Size:1378
Sequenced Size:1336

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5473 2002-01-01 Sim4 clustering to Release 2
CG5473 2002-05-18 Blastp of sequenced clone
CG5473 2003-01-01 Sim4 clustering to Release 3
SP2637 2008-04-29 Release 5.5 accounting
SP2637 2008-08-15 Release 5.9 accounting
SP2637 2008-12-18 5.12 accounting

Clone Sequence Records

LD05256.complete Sequence

1336 bp (1336 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118895

> LD05256.complete
AAAAATTGCAACGCTAGCAAGTGGAAATTGACGAATTATTATTTAACTAT
GAGCTTAAACTGTGAGCTGTGAGGAATTGTGAAAAGTGCACGAATCGCTG
AACTATTTGGTGCTATGTAAATTTTGCCTGCTACTCATCTTGCTCGAGAG
CCAAAATCCAAGCAATTGAAAGCGAAACCCTTGCGAGAGGGTCAAGGAAG
GATACAACAGACGAACAGACAGCCAGGATGGTGCTCGTGCTGAATGGTGT
GCTGCAGGATGACTGCCCCATGGACACCAACAGCCTGTTCCTGCAGCATC
CCGTCTACAGAGACTACGCCCAGCAGCTGCACTCCATTCAGGCCAAGTCG
GTGGGTCCGGTGGGTCTGCTCTACGTGGGTCAGCGGGAGATGGCCGCCTC
TGCCCCGCACGACAAGCACGTCAACATCATCGGTGCCGACGATGCCACCA
CCTGTATTATCGTTGTGGTCCGGCACTCCGGATCTGGTGCTGTGGCCCTG
GCGCACTTCGATGGCAGCGGCGTGGACGAGGCTGTGTGCACCATGGTGTC
GCGGGTTCAGGAGCTGGCCGTCGGCTATCCGGAGGGTCGCATCGAGTTGC
AGTTGATTGGTGGCTATCGCGATGCCAAGGGATACGGCGAGGACGTATTC
TTCAGCATTATGCAATCATTCCACAATCACCTACTTGAAATCGATCTGAC
GCAGGCTTGCGTGGGCGAGCTAAATACCATGATGCGCGGCGAGATCAACT
GCCCCATCATCTATGGAGTGGGCGTGAACATCAAGACTGGTGAGATCTTT
CCGGCCTCCTTTCCAGACCGAGGACCCGACCGGGAGCTACGCGATGCTCG
CATCTTCATGGGCGCGCAGTCGGTTCTGGATATATACGACTCCTCGCTGG
GCATGCTACGCATTGGACCCTTTAACTACGATCCTTTGCGCGGCGCTGAT
CTGTGGCTATCACAAACGGATGAGTTTCTGTTGCAGCACCTGTCCTCCAG
TCCAGACGTGGAGCCGCCTCACTTTGCGCCTCAGACGCGTGCCACCATTA
GGTTTATACAGGAGAATCAGTTCCCCGCCGTCACCGTTTTCAGGGACAAT
CGGCCGCGCTACTTCCGGCGGGATGACGCCACGGGCTTCTGGGTGCTGAT
ACAAGATTGAGTTCCGACGCTGGAGACGGTTGCTTGGGACGAGCCTTAGA
AATGGATCTGAACTGGGAACGTAAAAGCGATATATAACGATAAATAATTA
TTACAATTCTATGTGCAAATGTGCATGTAAATATTTATGTGAACCCCATT
AAAGAACCTATTACTATTTAAAAAAAAAAAAAAAAA

LD05256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
SP2637-RA 1529 SP2637-RA 46..1368 1..1323 6615 100 Plus
SP2637-RC 1789 SP2637-RC 44..1191 1..1148 5740 100 Plus
SP2637.a 1750 SP2637.a 2..1153 1..1148 5675 99.6 Plus
SP2637-RC 1789 SP2637-RC 1456..1631 1148..1323 880 100 Plus
SP2637.a 1750 SP2637.a 1418..1593 1148..1323 880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14529536..14529894 481..123 1735 98.9 Minus
chr2R 21145070 chr2R 14528989..14529199 874..664 1055 100 Minus
chr2R 21145070 chr2R 14529264..14529447 663..480 905 99.5 Minus
chr2R 21145070 chr2R 14528155..14528326 1319..1148 860 100 Minus
chr2R 21145070 chr2R 14528767..14528929 1034..872 800 99.4 Minus
chr2R 21145070 chr2R 14545206..14545327 122..1 610 100 Minus
chr2R 21145070 chr2R 14528591..14528707 1148..1032 585 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18642404..18642762 481..123 1795 100 Minus
2R 25286936 2R 18641857..18642067 874..664 1055 100 Minus
2R 25286936 2R 18642132..18642315 663..480 920 100 Minus
2R 25286936 2R 18641019..18641194 1323..1148 880 100 Minus
2R 25286936 2R 18641635..18641797 1034..872 815 100 Minus
2R 25286936 2R 18658080..18658201 122..1 610 100 Minus
2R 25286936 2R 18641459..18641575 1148..1032 585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18643603..18643961 481..123 1795 100 Minus
2R 25260384 2R 18643056..18643266 874..664 1055 100 Minus
2R 25260384 2R 18643331..18643514 663..480 920 100 Minus
2R 25260384 2R 18642218..18642393 1323..1148 880 100 Minus
2R 25260384 2R 18642834..18642996 1034..872 815 100 Minus
2R 25260384 2R 18659279..18659400 122..1 610 100 Minus
2R 25260384 2R 18642658..18642774 1148..1032 585 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:21:19 has no hits.

LD05256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:22:15 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14528155..14528325 1149..1319 100 <- Minus
chr2R 14528591..14528704 1035..1148 100 <- Minus
chr2R 14528767..14528928 873..1034 99 <- Minus
chr2R 14528991..14529199 664..872 100 <- Minus
chr2R 14529264..14529446 481..663 99 <- Minus
chr2R 14529537..14529894 123..480 98 <- Minus
chr2R 14545206..14545327 1..122 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:43:51 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RB 1..933 228..1160 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:57 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RB 1..933 228..1160 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:59:59 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 1..933 228..1160 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:37:08 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RB 1..933 228..1160 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:59:10 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 1..933 228..1160 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:43:50 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 1..1318 2..1319 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:57 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 1..1319 1..1319 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:59:59 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 22..1340 1..1319 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:37:08 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 1..1318 2..1319 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:59:10 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
SP2637-RA 22..1340 1..1319 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:15 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18642132..18642314 481..663 100 <- Minus
2R 18642405..18642762 123..480 100 <- Minus
2R 18658080..18658201 1..122 100   Minus
2R 18641023..18641193 1149..1319 100 <- Minus
2R 18641459..18641572 1035..1148 100 <- Minus
2R 18641635..18641796 873..1034 100 <- Minus
2R 18641859..18642067 664..872 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:15 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18642132..18642314 481..663 100 <- Minus
2R 18642405..18642762 123..480 100 <- Minus
2R 18658080..18658201 1..122 100   Minus
2R 18641023..18641193 1149..1319 100 <- Minus
2R 18641459..18641572 1035..1148 100 <- Minus
2R 18641635..18641796 873..1034 100 <- Minus
2R 18641859..18642067 664..872 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:22:15 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18642132..18642314 481..663 100 <- Minus
2R 18642405..18642762 123..480 100 <- Minus
2R 18658080..18658201 1..122 100   Minus
2R 18641023..18641193 1149..1319 100 <- Minus
2R 18641459..18641572 1035..1148 100 <- Minus
2R 18641635..18641796 873..1034 100 <- Minus
2R 18641859..18642067 664..872 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:59:59 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14545585..14545706 1..122 100   Minus
arm_2R 14528528..14528698 1149..1319 100 <- Minus
arm_2R 14528964..14529077 1035..1148 100 <- Minus
arm_2R 14529140..14529301 873..1034 100 <- Minus
arm_2R 14529364..14529572 664..872 100 <- Minus
arm_2R 14529637..14529819 481..663 100 <- Minus
arm_2R 14529910..14530267 123..480 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:09:32 Download gff for LD05256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18643058..18643266 664..872 100 <- Minus
2R 18643331..18643513 481..663 100 <- Minus
2R 18643604..18643961 123..480 100 <- Minus
2R 18659279..18659400 1..122 100   Minus
2R 18642222..18642392 1149..1319 100 <- Minus
2R 18642658..18642771 1035..1148 100 <- Minus
2R 18642834..18642995 873..1034 100 <- Minus

LD05256.pep Sequence

Translation from 227 to 1159

> LD05256.pep
MVLVLNGVLQDDCPMDTNSLFLQHPVYRDYAQQLHSIQAKSVGPVGLLYV
GQREMAASAPHDKHVNIIGADDATTCIIVVVRHSGSGAVALAHFDGSGVD
EAVCTMVSRVQELAVGYPEGRIELQLIGGYRDAKGYGEDVFFSIMQSFHN
HLLEIDLTQACVGELNTMMRGEINCPIIYGVGVNIKTGEIFPASFPDRGP
DRELRDARIFMGAQSVLDIYDSSLGMLRIGPFNYDPLRGADLWLSQTDEF
LLQHLSSSPDVEPPHFAPQTRATIRFIQENQFPAVTVFRDNRPRYFRRDD
ATGFWVLIQD*

LD05256.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12800-PA 310 GF12800-PA 1..309 1..309 1596 95.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20959-PA 310 GG20959-PA 1..310 1..310 1651 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21856-PA 310 GH21856-PA 1..309 1..309 1558 92.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
SP2637-PB 310 CG5473-PB 1..310 1..310 1630 100 Plus
SP2637-PA 310 CG5473-PA 1..310 1..310 1630 100 Plus
SP2637-PD 310 CG5473-PD 1..309 1..309 1619 99.4 Plus
SP2637-PC 310 CG5473-PC 1..309 1..309 1619 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20358-PA 310 GI20358-PA 1..309 1..309 1573 93.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11325-PA 310 GL11325-PA 1..309 1..309 1593 95.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18907-PA 310 GA18907-PA 1..309 1..309 1593 95.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19890-PA 310 GM19890-PA 1..310 1..310 1651 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25375-PA 310 GD25375-PA 1..310 1..310 1651 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22083-PA 310 GJ22083-PA 1..309 1..309 1568 93.2 Plus
Dvir\GJ14936-PA 99 GJ14936-PA 1..49 1..49 240 93.9 Plus
Dvir\GJ14936-PA 99 GJ14936-PA 51..98 260..303 146 62.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15790-PA 310 GK15790-PA 1..309 1..309 1564 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13898-PA 310 GE13898-PA 1..310 1..310 1650 99.7 Plus

LD05256.hyp Sequence

Translation from 227 to 1159

> LD05256.hyp
MVLVLNGVLQDDCPMDTNSLFLQHPVYRDYAQQLHSIQAKSVGPVGLLYV
GQREMAASAPHDKHVNIIGADDATTCIIVVVRHSGSGAVALAHFDGSGVD
EAVCTMVSRVQELAVGYPEGRIELQLIGGYRDAKGYGEDVFFSIMQSFHN
HLLEIDLTQACVGELNTMMRGEINCPIIYGVGVNIKTGEIFPASFPDRGP
DRELRDARIFMGAQSVLDIYDSSLGMLRIGPFNYDPLRGADLWLSQTDEF
LLQHLSSSPDVEPPHFAPQTRATIRFIQENQFPAVTVFRDNRPRYFRRDD
ATGFWVLIQD*

LD05256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
SP2637-PB 310 CG5473-PB 1..310 1..310 1630 100 Plus
SP2637-PA 310 CG5473-PA 1..310 1..310 1630 100 Plus
SP2637-PD 310 CG5473-PD 1..309 1..309 1619 99.4 Plus
SP2637-PC 310 CG5473-PC 1..309 1..309 1619 99.4 Plus