Clone LD05259 Report

Search the DGRC for LD05259

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:52
Well:59
Vector:pBS SK-
Associated Gene/TranscriptGasp-RA
Protein status:LD05259.pep: gold
Preliminary Size:1586
Sequenced Size:1454

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10287 2001-01-01 Release 2 assignment
CG10287 2001-11-09 Blastp of sequenced clone
CG10287 2003-01-01 Sim4 clustering to Release 3
Gasp 2008-04-29 Release 5.5 accounting
Gasp 2008-08-15 Release 5.9 accounting
Gasp 2008-12-18 5.12 accounting

Clone Sequence Records

LD05259.complete Sequence

1454 bp (1454 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069336

> LD05259.complete
AGTCAGTTCAGAGTTTTTGAGCTTGAATTTCAGTCTCAGTTTTTTCAAGT
GCGGTTCCGTCGGTCCCGATCCCAACTAAAATACAAATAACTACACTCGC
AAAATGAAGAAGTTTCTCGTGGTGTTTGTGGCATTATTCGGAGCCGCTGT
GGCCCAAAGTAGCTTTAAGTGTCCCGATGACTTTGGATTCTATCCACATG
ACACGTCCTGCGACAAGTACTGGAAGTGCGACAACGGCGTTTCCGAGCTG
AAGACCTGTGGAAACGGTCTGGCTTTCGATGCCACAGACTCCAAGTACCT
AACCGAAAACTGCGACTATCTACACAACGTGGATTGCGGCGATCGCACAG
AGCTGGAGCCCCCAATTACCACCCCCCACTGCTCTCGCCTGTACGGCATC
TTCCCCGATGAGAACAAGTGCGACGTGTTCTGGAACTGCTGGAACGGCGA
GCCCTCCAGATACCAGTGCTCCCCCGGATTGGCTTACGATCGCGATGCTC
GCGTGTGCATGTGGGCTGACCAGGTGCCTGAGTGCAAGAACGAAGAGGTG
GCCAACGGATTCTCTTGCCCGGCGGCTGGTGAGCTGGCCAACGCCGGATC
CTTCTCGCGCCACGCCCATCCCGAGGACTGCCGCAAGTACTACATCTGCC
TGGAGGGTGTGGCACGCGAGTACGGATGCCCCATCGGCACAGTGTTCAAG
ATTGGCGACAGTGATGGCACTGGCAACTGCGAGGATCCCGAGGATGTTCC
CGGGTGTGAGGACTACTACGGCGATCTGGATTTGAAGAGCATCCGCAAGA
GCGAACTTCTAGCTGGACTGAACAGTGAAGGTCGCACTAAGGGCGCGCCA
AAAACCAAAGCTGCCTCCTCCTCCTCATAAACATAACATCTACAACAAGA
ACCTACAACTTTAACAACAATAACTAAACAACAACAGCAACTATAACTAC
AAAACAATACAACAAGATCAATCAACTCAGATACCCCGTTCCCATTCTGC
CAAAAATCCCCCACATCACAAATCAGATTAGAATCAAAAGATAGAACCTC
AAACCGAAATTCGTACCACATCAAGAACTATTTTCCTGCCATTTTCGAAC
TTCTCAGTTGACTCCTGTACTGTGCTTCTAATTTATGAATCTATAAATCT
CTCTCGTTTCGTCTGAGTCAAACATTGCTGTCTCTTCATGTTTCCGTTTT
CAACAAGTATAAAACACATCGAAATTGCCACGCAAATTCAGGCTCGAAGA
ACTAACACAAAATTTTGTAAACAAAATATAGAGAACATCGAGGAATGAAA
GAAATCGTTCAATATGAAGCGTAAAATTTAGAGATTTGTACATTTAAGTG
ATCCTTGTTTATAAGATTATAATTTTATTTTATACATAAAAACGAAAAAC
AACAAAAATATATAAAGAAAAAAACAATAAAAAAAAAAAAAAAAAAAAAA
AAAA

LD05259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Gasp.c 1832 Gasp.c 247..1675 1..1429 7145 100 Plus
Gasp.a 2289 Gasp.a 704..2132 1..1429 7145 100 Plus
Gasp-RA 1832 Gasp-RA 247..1675 1..1429 7145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1918636..1919315 1428..756 3260 99 Minus
chr3R 27901430 chr3R 1919867..1920079 756..544 1065 100 Minus
chr3R 27901430 chr3R 1920451..1920661 356..146 1055 100 Minus
chr3R 27901430 chr3R 1920144..1920333 545..356 950 100 Minus
chr3R 27901430 chr3R 1926350..1926495 146..1 730 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6093002..6093675 1429..756 3370 100 Minus
3R 32079331 3R 6094227..6094439 756..544 1065 100 Minus
3R 32079331 3R 6094811..6095021 356..146 1055 100 Minus
3R 32079331 3R 6094504..6094693 545..356 950 100 Minus
3R 32079331 3R 6100710..6100855 146..1 730 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5833833..5834506 1429..756 3370 100 Minus
3R 31820162 3R 5835058..5835270 756..544 1065 100 Minus
3R 31820162 3R 5835642..5835852 356..146 1055 100 Minus
3R 31820162 3R 5835335..5835524 545..356 950 100 Minus
3R 31820162 3R 5841541..5841686 146..1 730 100 Minus
Blast to na_te.dros performed 2019-03-16 04:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2568..2718 1277..1423 123 56.3 Plus

LD05259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:03:18 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1919189..1919314 757..882 100 <- Minus
chr3R 1919867..1920077 546..756 100 <- Minus
chr3R 1920144..1920332 357..545 100 <- Minus
chr3R 1920451..1920660 147..356 100 <- Minus
chr3R 1926350..1926495 1..146 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:36:20 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 1..777 104..880 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:30:55 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 1..777 104..880 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:36 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 1..777 104..880 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:58:34 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 1..777 104..880 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:23:54 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 1..777 104..880 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:09:08 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 33..1460 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:30:55 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 33..1460 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:36 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 33..1460 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:58:34 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 33..1460 1..1428 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:23:54 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
Gasp-RA 33..1460 1..1428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:18 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6094504..6094692 357..545 100 <- Minus
3R 6094811..6095020 147..356 100 <- Minus
3R 6100710..6100855 1..146 100   Minus
3R 6093003..6093674 757..1428 100 <- Minus
3R 6094227..6094437 546..756 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:18 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6094504..6094692 357..545 100 <- Minus
3R 6094811..6095020 147..356 100 <- Minus
3R 6100710..6100855 1..146 100   Minus
3R 6093003..6093674 757..1428 100 <- Minus
3R 6094227..6094437 546..756 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:18 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6094504..6094692 357..545 100 <- Minus
3R 6094811..6095020 147..356 100 <- Minus
3R 6100710..6100855 1..146 100   Minus
3R 6093003..6093674 757..1428 100 <- Minus
3R 6094227..6094437 546..756 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:36 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1918725..1919396 757..1428 100 <- Minus
arm_3R 1919949..1920159 546..756 100 <- Minus
arm_3R 1920226..1920414 357..545 100 <- Minus
arm_3R 1920533..1920742 147..356 100 <- Minus
arm_3R 1926432..1926577 1..146 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:34:58 Download gff for LD05259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5835335..5835523 357..545 100 <- Minus
3R 5835642..5835851 147..356 100 <- Minus
3R 5841541..5841686 1..146 100   Minus
3R 5833834..5834505 757..1428 100 <- Minus
3R 5835058..5835268 546..756 100 <- Minus

LD05259.pep Sequence

Translation from 103 to 879

> LD05259.pep
MKKFLVVFVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELK
TCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIF
PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVA
NGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKI
GDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSELLAGLNSEGRTKGAPK
TKAASSSS*

LD05259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18629-PA 257 GF18629-PA 1..257 1..257 1366 99.2 Plus
Dana\GF20239-PA 239 GF20239-PA 1..238 1..229 377 37.4 Plus
Dana\GF15739-PA 322 GF15739-PA 75..304 22..255 328 34.3 Plus
Dana\GF20240-PA 230 GF20240-PA 1..229 1..223 281 32.8 Plus
Dana\GF14304-PA 237 GF14304-PA 11..191 20..192 256 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10600-PA 258 GG10600-PA 1..258 1..258 1371 99.6 Plus
Dere\GG19275-PA 237 GG19275-PA 1..236 1..229 391 36.9 Plus
Dere\GG10079-PA 333 GG10079-PA 85..314 22..255 320 34.3 Plus
Dere\GG19276-PA 230 GG19276-PA 1..229 1..223 288 33.6 Plus
Dere\GG24283-PA 250 GG24283-PA 1..203 1..192 266 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14287-PA 255 GH14287-PA 1..255 1..256 1318 96.1 Plus
Dgri\GH12617-PA 235 GH12617-PA 1..235 1..229 391 37.3 Plus
Dgri\GH11070-PA 313 GH11070-PA 63..266 18..224 313 34.9 Plus
Dgri\GH12618-PA 230 GH12618-PA 6..229 1..223 281 32.2 Plus
Dgri\GH10689-PA 249 GH10689-PA 1..222 1..220 254 30.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Gasp-PA 258 CG10287-PA 1..258 1..258 1451 100 Plus
Gasp-PB 235 CG10287-PB 1..232 1..232 1317 98.3 Plus
obst-A-PB 237 CG17052-PB 1..235 1..228 429 37 Plus
obst-A-PA 237 CG17052-PA 1..235 1..228 429 37 Plus
obst-B-PA 337 CG4778-PA 85..284 22..224 351 36.1 Plus
Peritrophin-A-PB 230 CG17058-PB 1..228 1..221 322 34.6 Plus
Peritrophin-A-PA 230 CG17058-PA 1..228 1..221 322 34.6 Plus
obst-E-PB 249 CG11142-PB 1..225 1..218 306 32.6 Plus
obst-E-PA 242 CG11142-PA 1..221 1..218 288 31.4 Plus
Peritrophin-A-PC 157 CG17058-PC 1..154 1..148 246 35.9 Plus
CG10725-PB 269 CG10725-PB 93..254 32..198 168 27.6 Plus
teq-PC 563 CG4821-PC 65..252 23..198 162 27.6 Plus
teq-PF 2379 CG4821-PF 65..252 23..198 162 27.6 Plus
teq-PG 2792 CG4821-PG 65..252 23..198 162 27.6 Plus
CG10154-PB 316 CG10154-PB 140..314 32..215 153 27.4 Plus
CG10154-PA 316 CG10154-PA 140..314 32..215 153 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23181-PA 256 GI23181-PA 1..256 1..256 1336 96.1 Plus
Dmoj\GI11032-PA 247 GI11032-PA 1..231 1..224 382 37.9 Plus
Dmoj\GI17587-PA 316 GI17587-PA 58..296 13..255 325 33.9 Plus
Dmoj\GI11033-PA 230 GI11033-PA 10..229 4..223 281 33 Plus
Dmoj\GI11221-PA 233 GI11221-PA 1..233 1..239 272 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23484-PA 259 GL23484-PA 1..258 1..258 1346 96.9 Plus
Dper\GL13082-PA 238 GL13082-PA 1..237 1..229 385 36.7 Plus
Dper\GL18956-PA 316 GL18956-PA 65..302 14..255 335 33.6 Plus
Dper\GL13083-PA 230 GL13083-PA 1..228 1..221 268 32.1 Plus
Dper\GL19116-PA 243 GL19116-PA 1..221 1..218 266 32.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10221-PA 259 GA10221-PA 1..258 1..258 1346 96.9 Plus
Dpse\GA14300-PA 238 GA14300-PA 1..237 1..229 385 36.7 Plus
Dpse\GA18424-PA 316 GA18424-PA 65..302 14..255 335 33.6 Plus
Dpse\GA14302-PA 230 GA14302-PA 1..228 1..221 275 32.5 Plus
Dpse\GA10790-PA 243 GA10790-PA 9..221 6..218 265 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10569-PA 258 GM10569-PA 1..258 1..258 1369 99.6 Plus
Dsec\GM17883-PA 334 GM17883-PA 85..314 22..255 320 34.3 Plus
Dsec\GM23014-PA 226 GM23014-PA 1..225 1..229 316 33.2 Plus
Dsec\GM23015-PA 230 GM23015-PA 1..229 1..223 280 33.2 Plus
Dsec\GM17998-PA 242 GM17998-PA 1..221 1..218 252 31.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19561-PA 258 GD19561-PA 1..258 1..258 1371 99.6 Plus
Dsim\GD23651-PA 334 GD23651-PA 85..314 22..255 320 34.3 Plus
Dsim\GD17481-PA 230 GD17481-PA 1..229 1..223 288 33.6 Plus
Dsim\GD17480-PA 429 GD17480-PA 167..313 14..156 266 38.4 Plus
Dsim\GD22632-PA 249 GD22632-PA 1..238 1..234 263 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14495-PA 256 GJ14495-PA 1..256 1..256 1331 95.7 Plus
Dvir\GJ15813-PA 237 GJ15813-PA 1..236 1..229 387 37.6 Plus
Dvir\GJ17929-PA 313 GJ17929-PA 63..296 18..255 319 33.7 Plus
Dvir\GJ15814-PA 230 GJ15814-PA 10..228 5..221 287 32.9 Plus
Dvir\GJ18329-PA 242 GJ18329-PA 15..231 19..234 257 32.2 Plus
Dvir\GJ18329-PA 242 GJ18329-PA 81..218 17..144 144 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14210-PA 256 GK14210-PA 1..256 1..256 1335 96.1 Plus
Dwil\GK25193-PA 233 GK25193-PA 1..230 1..224 367 35.7 Plus
Dwil\GK12722-PA 309 GK12722-PA 63..262 22..224 313 35.1 Plus
Dwil\GK25194-PA 233 GK25194-PA 12..231 4..221 274 32.3 Plus
Dwil\GK15420-PA 244 GK15420-PA 1..221 1..218 260 32.3 Plus
Dwil\GK12722-PA 309 GK12722-PA 127..256 18..144 145 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24117-PA 258 GE24117-PA 1..258 1..258 1365 99.2 Plus
Dyak\GE17864-PA 237 GE17864-PA 1..236 1..229 392 36.9 Plus
Dyak\GE18893-PA 334 GE18893-PA 85..314 22..255 318 34.3 Plus
Dyak\GE17865-PA 230 GE17865-PA 1..229 1..223 287 33.6 Plus
Dyak\GE18979-PA 249 GE18979-PA 1..203 1..192 261 33.8 Plus

LD05259.hyp Sequence

Translation from 103 to 879

> LD05259.hyp
MKKFLVVFVALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELK
TCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIF
PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVA
NGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKI
GDSDGTGNCEDPEDVPGCEDYYGDLDLKSIRKSELLAGLNSEGRTKGAPK
TKAASSSS*

LD05259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Gasp-PA 258 CG10287-PA 1..258 1..258 1451 100 Plus
Gasp-PB 235 CG10287-PB 1..232 1..232 1317 98.3 Plus
obst-A-PB 237 CG17052-PB 1..235 1..228 429 37 Plus
obst-A-PA 237 CG17052-PA 1..235 1..228 429 37 Plus
obst-B-PA 337 CG4778-PA 85..284 22..224 351 36.1 Plus