Clone LD05267 Report

Search the DGRC for LD05267

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:52
Well:67
Vector:pBS SK-
Associated Gene/TranscriptCG5885-RA
Protein status:LD05267.pep: gold
Preliminary Size:1117
Sequenced Size:913

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5885 2001-01-01 Release 2 assignment
CG5885 2002-05-17 Blastp of sequenced clone
CG5885 2003-01-01 Sim4 clustering to Release 3
CG5885 2008-04-29 Release 5.5 accounting
CG5885 2008-08-15 Release 5.9 accounting
CG5885 2008-12-18 5.12 accounting

Clone Sequence Records

LD05267.complete Sequence

913 bp (913 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118492

> LD05267.complete
ATTCGTCGAAGCCGACTTGCGTTTGCATTCGTGTACACTTTACCGCACTC
TTCGCTACTTTCTCTACGAAAATCGAACTGAAAAATGGGATCCGGCAAAC
AACAGAAAGTCCAGTCCTCTGGCTTCACCAAGGAAGAGGAGCTGCTGCTG
CAGGACTTTAGCCGCAACGTGAGCACCAAGTCGTCGGCGCTGTTCTACGG
CAATGCCTTTATCGTGTCGGCCGTTCCAATCTGGCTCTTCTGGCGCATCC
ACAACATGGACTTGTGGCCCAGCTCCATCCTGTTCGTCCTGGTGACGGCC
GCTAGTACTTATCTGATGGCCACCGCCTACAAGAACATCAAGTTCCAGCT
GAAGCACAAGATCGCCGGACGGCGGGAGGAGGCGGTGACCCGCGAGGTCA
ACCGTCAGGTGGGCGATGACAAGAAGGTCACGCGCAAGGAAAAGGACGAG
CGCATCCTGTGGAAGAAGAACGAGGTAGCCGACTACGAGGCCACCACCTT
CTCCATCTTCTACAACAACGCCATCTACCTGGCCGTTATCATTTTCATCA
GCTTCTTTATCCTGAAGAACTCGACGCCGTTCATCAACTACATCTTTTCC
GTGGGCATCGCCAGCGGCGCTCTGTCGCTCTTCTCCACCAGCGCACAGAC
GAACTGAGCGAATGTGCAGCCATGTCATCCCATGTTCATGTACTCGTAAT
GTAAGGCCCTTCAAGAGATTTCCTGGTACAGCGGGCTGGTCCTTCATCCG
CCAACCCCCGTCCCATTGGCGTTTCCAGCAGTGCGAGCATAGAAATTTTA
TAGTATAAACACCAACTTGTCTTTCTTGTAGAAAGCTGATCAACTTCCAT
TCGCTGCTGATTGAATAAATTGTAAAGATAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

LD05267.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5885-RA 1122 CG5885-RA 229..1111 1..883 4415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9916144..9916788 877..233 3165 99.4 Minus
chr2L 23010047 chr2L 9916854..9917086 233..1 1150 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9917217..9917867 883..233 3255 100 Minus
2L 23513712 2L 9917933..9918165 233..1 1165 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9917217..9917867 883..233 3255 100 Minus
2L 23513712 2L 9917933..9918165 233..1 1165 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:41:47 has no hits.

LD05267.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:42:42 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9916142..9916788 233..879 99 <- Minus
chr2L 9916855..9917086 1..232 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:36:24 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..573 85..657 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:05 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..573 85..657 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:39 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..573 85..657 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:36 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..573 85..657 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:46:16 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..573 85..657 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:25:54 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..879 1..879 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:05 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..879 1..879 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:39 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 12..890 1..879 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:41:37 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 1..879 1..879 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:46:16 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
CG5885-RA 12..890 1..879 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:42 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9917221..9917867 233..879 100 <- Minus
2L 9917934..9918165 1..232 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:42 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9917221..9917867 233..879 100 <- Minus
2L 9917934..9918165 1..232 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:42 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9917221..9917867 233..879 100 <- Minus
2L 9917934..9918165 1..232 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:39 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9917221..9917867 233..879 100 <- Minus
arm_2L 9917934..9918165 1..232 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:13:57 Download gff for LD05267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9917934..9918165 1..232 100   Minus
2L 9917221..9917867 233..879 100 <- Minus

LD05267.hyp Sequence

Translation from 84 to 656

> LD05267.hyp
MGSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIW
LFWRIHNMDLWPSSILFVLVTAASTYLMATAYKNIKFQLKHKIAGRREEA
VTREVNRQVGDDKKVTRKEKDERILWKKNEVADYEATTFSIFYNNAIYLA
VIIFISFFILKNSTPFINYIFSVGIASGALSLFSTSAQTN*

LD05267.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5885-PA 190 CG5885-PA 1..190 1..190 961 100 Plus

LD05267.pep Sequence

Translation from 84 to 656

> LD05267.pep
MGSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIW
LFWRIHNMDLWPSSILFVLVTAASTYLMATAYKNIKFQLKHKIAGRREEA
VTREVNRQVGDDKKVTRKEKDERILWKKNEVADYEATTFSIFYNNAIYLA
VIIFISFFILKNSTPFINYIFSVGIASGALSLFSTSAQTN*

LD05267.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14152-PA 190 GF14152-PA 1..190 1..190 986 97.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23997-PA 190 GG23997-PA 1..190 1..190 989 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10436-PA 190 GH10436-PA 1..190 1..190 947 91.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5885-PB 190 CG5885-PB 1..190 1..190 961 100 Plus
CG5885-PA 190 CG5885-PA 1..190 1..190 961 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24333-PA 190 GI24333-PA 1..190 1..190 950 92.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19200-PA 190 GL19200-PA 1..190 1..190 971 95.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19202-PA 190 GA19202-PA 1..190 1..190 971 95.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12147-PA 190 GM12147-PA 1..190 1..190 987 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22325-PA 190 GD22325-PA 1..190 1..190 990 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21594-PA 190 GJ21594-PA 1..190 1..190 944 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18103-PA 190 GK18103-PA 1..190 1..190 954 93.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10193-PA 190 GE10193-PA 1..190 1..190 989 98.9 Plus