Clone LD05272 Report

Search the DGRC for LD05272

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:52
Well:72
Vector:pBS SK-
Associated Gene/TranscriptCG32536-RA
Protein status:LD05272.pep: gold
Preliminary Size:1096
Sequenced Size:889

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8020 2001-01-01 Release 2 assignment
CG32536 2003-01-01 Sim4 clustering to Release 3
CG32536 2005-02-01 Blastp of sequenced clone
CG32536 2008-04-29 Release 5.5 accounting
CG32536 2008-08-15 Release 5.9 accounting
CG32537 2008-08-15 Release 5.9 accounting
CG32536 2008-12-18 5.12 accounting
CG32537 2008-12-18 5.12 accounting

Clone Sequence Records

LD05272.complete Sequence

889 bp (889 high quality bases) assembled on 2005-02-01

GenBank Submission: BT021413

> LD05272.complete
TGAAATTTAGTAAATAATATAGAATAGGATAGTTAACCAGGTGACAATGC
TGCAGCAAATCAAGATGCTGGTGCTGGGCATCATCACGCTGTGCCGGCGT
GCCTTGTGCTGCTTCTCCAGGCGCCGCAAGCTCAGCCACAGCGGCTCCGC
CACCGGATCCGCCGACCAACTGCAAGCGGTCAACGTGATCGTGGAGCGAG
GCGACTTCTCCGCCACCGGCGCCACCTCCGCTGGCCAGGCCGGCGGTGGC
AGGACAGCGGGGGCGCGCGAGCGGGACTGGAACTCCTGGGACGACAGTCC
GCGCACCGTGGAGGAGCACATCGAGCAGTACCGCCAGCGAATGGCCCAGC
CACCCACTCCGCCCAAGGAGGAACCCGAACCGGACTTCTTCAGTGAGCTG
ACGCCCACCATCAAGCCGCAGATGAAGTTCTACCTGGAGGATCCATCCAC
GAGTGCGGCGACCAGCCAACAAAGTGACTTTTCAAGACTGCAGGCCCAGG
ACTTGGTGCCAATTAGCGTAAATGCCGATCTCGAGGACTGGGTGGATGAT
AATGCCGGCGGCTGGGAGGAGCTGGACACCTCCCAGACCAAGCACATTCT
GCGTGAGAAGCGTCGTGAGTTGCGCCATCAGCGACAGCCGCCCGTCCGCC
CGGCCCCGCCCACTGTGGGCGCTCAGCGACTGACCGCCGGACAGCGAGCG
GCGTAGTTGTAGCTGCACCAGCCCCTAGCCAACCTCACCAACCTCACCAG
CCTCACCCACTCTGACCATTCCACAACCGACCACCTGCATTCTGTTTCCC
CTTTCTTTTGTTCGATTTAGTTGATTGGCTACACGAAATAAATCTTGCCT
TTCACTCGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD05272.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32536-RA 861 CG32536-RA 3..861 1..859 4295 100 Plus
CG32537-RA 2444 CG32537-RA 323..788 395..860 2330 100 Plus
CG32537-RA 2444 CG32537-RA 1..64 332..395 320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19165391..19165785 395..1 1945 99.5 Minus
chrX 22417052 chrX 19163916..19164251 859..524 1680 100 Minus
chrX 22417052 chrX 19164311..19164440 524..395 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19276476..19276870 395..1 1975 100 Minus
X 23542271 X 19275003..19275339 860..524 1685 100 Minus
X 23542271 X 19275399..19275528 524..395 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19284574..19284968 395..1 1975 100 Minus
X 23527363 X 19283101..19283437 860..524 1685 100 Minus
X 23527363 X 19283497..19283626 524..395 650 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:15:39 has no hits.

LD05272.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:16:32 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19163916..19164251 524..859 100 <- Minus
chrX 19164312..19164440 395..523 100 <- Minus
chrX 19165392..19165785 1..394 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:36:27 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 1..660 47..706 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:50 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 1..660 47..706 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:09 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 1..660 47..706 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:56:28 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 1..660 47..706 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:26:29 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 1..660 47..706 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:06:10 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 3..861 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:50 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 3..861 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:09 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 29..887 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:56:28 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 3..861 1..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:26:29 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
CG32536-RA 29..887 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:32 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
X 19275004..19275339 524..859 100 <- Minus
X 19275400..19275528 395..523 100 <- Minus
X 19276477..19276870 1..394 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:32 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
X 19275004..19275339 524..859 100 <- Minus
X 19275400..19275528 395..523 100 <- Minus
X 19276477..19276870 1..394 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:32 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
X 19275004..19275339 524..859 100 <- Minus
X 19275400..19275528 395..523 100 <- Minus
X 19276477..19276870 1..394 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:09 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19169037..19169372 524..859 100 <- Minus
arm_X 19169433..19169561 395..523 100 <- Minus
arm_X 19170510..19170903 1..394 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:43 Download gff for LD05272.complete
Subject Subject Range Query Range Percent Splice Strand
X 19283102..19283437 524..859 100 <- Minus
X 19283498..19283626 395..523 100 <- Minus
X 19284575..19284968 1..394 100   Minus

LD05272.pep Sequence

Translation from 46 to 705

> LD05272.pep
MLQQIKMLVLGIITLCRRALCCFSRRRKLSHSGSATGSADQLQAVNVIVE
RGDFSATGATSAGQAGGGRTAGARERDWNSWDDSPRTVEEHIEQYRQRMA
QPPTPPKEEPEPDFFSELTPTIKPQMKFYLEDPSTSAATSQQSDFSRLQA
QDLVPISVNADLEDWVDDNAGGWEELDTSQTKHILREKRRELRHQRQPPV
RPAPPTVGAQRLTAGQRAA*

LD05272.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15950-PA 215 GF15950-PA 1..215 7..219 810 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18063-PA 412 GG18063-PA 310..412 117..219 516 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12138-PA 197 GH12138-PA 1..197 7..219 688 69.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32536-PA 219 CG32536-PA 1..219 1..219 1145 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10987-PA 196 GI10987-PA 1..196 7..219 707 72.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12988-PA 212 GL12988-PA 1..212 7..219 746 74.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23114-PA 212 GA23114-PA 1..212 7..219 746 74.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22750-PA 219 GM22750-PA 1..219 1..219 1055 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15586-PA 130 GD15586-PA 25..130 114..219 524 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19099-PA 205 GJ19099-PA 2..205 1..219 700 70.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25204-PA 214 GK25204-PA 1..214 1..219 647 66.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17399-PA 214 GE17399-PA 1..214 1..219 937 92.7 Plus

LD05272.hyp Sequence

Translation from 46 to 705

> LD05272.hyp
MLQQIKMLVLGIITLCRRALCCFSRRRKLSHSGSATGSADQLQAVNVIVE
RGDFSATGATSAGQAGGGRTAGARERDWNSWDDSPRTVEEHIEQYRQRMA
QPPTPPKEEPEPDFFSELTPTIKPQMKFYLEDPSTSAATSQQSDFSRLQA
QDLVPISVNADLEDWVDDNAGGWEELDTSQTKHILREKRRELRHQRQPPV
RPAPPTVGAQRLTAGQRAA*

LD05272.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32536-PA 219 CG32536-PA 1..219 1..219 1145 100 Plus