Clone LD05344 Report

Search the DGRC for LD05344

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:53
Well:44
Vector:pBS SK-
Associated Gene/TranscriptmRpL24-RA
Protein status:LD05344.pep: gold
Preliminary Size:1063
Sequenced Size:869

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8849 2001-01-01 Release 2 assignment
CG8849 2002-04-04 Blastp of sequenced clone
CG8849 2003-01-01 Sim4 clustering to Release 3
mRpL24 2008-04-29 Release 5.5 accounting
mRpL24 2008-08-15 Release 5.9 accounting
mRpL24 2008-12-18 5.12 accounting

Clone Sequence Records

LD05344.complete Sequence

869 bp (869 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095024

> LD05344.complete
TGATTGCAAGCCGCATTTAATTTACTAGTTCTTATTATTAATAATTGAAT
TAACCTTTCAAAATGCGTTTAACGCAATATTTGGCCAGCAAGTTGAAGAA
CTTTTCCAATCTGCCCAAGGAATACATCGAGCGCAGCAAAAAACAGGTGT
ACTGGCAAACTCCGAAGGAGATTAATTACCTACCGCGTACCGTGGAGCGA
AAGAGATTCCGCTACACCACAAATCGTTCATGGACGGGTCAGTTCCGCCA
GCAAAATATGCCCGGAACCGTGCGTCGCAAGGTGCTAGTGGAACCAATTG
AGGACTGGAGCTTTTTCCGCGGCGATCGTATCGAAGTCCTTGTGGGTAAA
GACAAAGGAAAGCAGGGAATTGTCACCCAGGTTATACCCGAGCGCAATTG
GGTAATTGTAGAGGGCCTGAACTGGCACTATCGCAAGGTTGGCGGTGAGA
AGGAGTTTCCCGGTATCATTATCAAGTCCGAGGCACCTTTGCACGTCACC
AAGGACATTCGTCTGGTTGACCCATCGGATCTTCAGGGCACCGACTTTGA
GTGGCGTTTCACGGAGGAGGGCGAGAAAGTGCGGGTGTCCTTGCGATCTG
GCCGAATCATACCCATCCCGGAGACGAACAACCAGACGCACGATTATAAA
ACACCAAACGCCTATATCGAAAGGGAGAAGGATACGCCAGGCGCTGTTGT
GGGCGAGATCACCTTTCAGCCCAAGTTGTCCACATTCGAGATGGACATTA
TGGAGGAAATGGGCATCAAAGAGGAACGCACGCCAGTCAAGAGCTATTGG
TACTAATGTTATGCCTACTGTTTATTAAAGTAATGTACAAAATACCCATA
TAAAAAAAAAAAAAAAAAA

LD05344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL24-RA 1108 mRpL24-RA 195..1047 1..853 4265 100 Plus
CG14044-RA 1350 CG14044-RA 1299..1350 853..802 260 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4943574..4943965 691..300 1960 100 Minus
chr2L 23010047 chr2L 4943356..4943519 851..688 820 100 Minus
chr2L 23010047 chr2L 4944027..4944184 300..143 790 100 Minus
chr2L 23010047 chr2L 4944290..4944437 148..1 740 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4944474..4944865 691..300 1960 100 Minus
2L 23513712 2L 4944254..4944419 853..688 830 100 Minus
2L 23513712 2L 4944927..4945084 300..143 790 100 Minus
2L 23513712 2L 4945190..4945337 148..1 740 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4944474..4944865 691..300 1960 100 Minus
2L 23513712 2L 4944254..4944419 853..688 830 100 Minus
2L 23513712 2L 4944927..4945084 300..143 790 100 Minus
2L 23513712 2L 4945190..4945337 148..1 740 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:41:55 has no hits.

LD05344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:42:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4943575..4943964 301..690 100 <- Minus
chr2L 4943356..4943516 691..851 100 <- Minus
chr2L 4944027..4944180 147..300 100 <- Minus
chr2L 4944292..4944437 1..146 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:36:38 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 1..744 63..806 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:10:22 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 1..744 63..806 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 1..744 63..806 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:41:14 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 1..744 63..806 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:46:25 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 1..744 63..806 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:01:30 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 7..857 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:10:22 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 7..857 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 25..875 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:41:15 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 7..857 1..851 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:46:25 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL24-RA 25..875 1..851 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4944256..4944416 691..851 100 <- Minus
2L 4944475..4944864 301..690 100 <- Minus
2L 4944927..4945080 147..300 100 <- Minus
2L 4945192..4945337 1..146 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4944256..4944416 691..851 100 <- Minus
2L 4944475..4944864 301..690 100 <- Minus
2L 4944927..4945080 147..300 100 <- Minus
2L 4945192..4945337 1..146 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4944256..4944416 691..851 100 <- Minus
2L 4944475..4944864 301..690 100 <- Minus
2L 4944927..4945080 147..300 100 <- Minus
2L 4945192..4945337 1..146 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:46 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4944256..4944416 691..851 100 <- Minus
arm_2L 4944475..4944864 301..690 100 <- Minus
arm_2L 4944927..4945080 147..300 100 <- Minus
arm_2L 4945192..4945337 1..146 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:18:51 Download gff for LD05344.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4944256..4944416 691..851 100 <- Minus
2L 4945192..4945337 1..146 100   Minus
2L 4944927..4945080 147..300 100 <- Minus
2L 4944475..4944864 301..690 100 <- Minus

LD05344.pep Sequence

Translation from 62 to 805

> LD05344.pep
MRLTQYLASKLKNFSNLPKEYIERSKKQVYWQTPKEINYLPRTVERKRFR
YTTNRSWTGQFRQQNMPGTVRRKVLVEPIEDWSFFRGDRIEVLVGKDKGK
QGIVTQVIPERNWVIVEGLNWHYRKVGGEKEFPGIIIKSEAPLHVTKDIR
LVDPSDLQGTDFEWRFTEEGEKVRVSLRSGRIIPIPETNNQTHDYKTPNA
YIEREKDTPGAVVGEITFQPKLSTFEMDIMEEMGIKEERTPVKSYWY*

LD05344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21543-PA 247 GF21543-PA 1..247 1..247 1195 95.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24340-PA 247 GG24340-PA 1..247 1..247 1280 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13595-PA 247 GH13595-PA 1..247 1..247 1220 91.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL24-PA 247 CG8849-PA 1..247 1..247 1317 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23613-PA 247 GI23613-PA 1..247 1..247 1205 91.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19491-PA 210 GL19491-PA 1..210 1..247 961 76.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21365-PA 247 GA21365-PA 1..247 1..247 1228 92.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18061-PA 247 GM18061-PA 1..247 1..247 1279 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22680-PA 139 GD22680-PA 1..139 1..139 722 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20804-PA 247 GJ20804-PA 1..247 1..247 1232 93.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24587-PA 247 GK24587-PA 1..247 1..247 1206 90.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18719-PA 247 GE18719-PA 1..247 1..247 1293 99.2 Plus

LD05344.hyp Sequence

Translation from 62 to 805

> LD05344.hyp
MRLTQYLASKLKNFSNLPKEYIERSKKQVYWQTPKEINYLPRTVERKRFR
YTTNRSWTGQFRQQNMPGTVRRKVLVEPIEDWSFFRGDRIEVLVGKDKGK
QGIVTQVIPERNWVIVEGLNWHYRKVGGEKEFPGIIIKSEAPLHVTKDIR
LVDPSDLQGTDFEWRFTEEGEKVRVSLRSGRIIPIPETNNQTHDYKTPNA
YIEREKDTPGAVVGEITFQPKLSTFEMDIMEEMGIKEERTPVKSYWY*

LD05344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL24-PA 247 CG8849-PA 1..247 1..247 1317 100 Plus