Clone LD05365 Report

Search the DGRC for LD05365

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:53
Well:65
Vector:pBS SK-
Associated Gene/Transcriptzuc-RA
Protein status:LD05365.pep: gold
Preliminary Size:1317
Sequenced Size:1145

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12314 2001-01-01 Release 2 assignment
CG12314 2002-05-17 Blastp of sequenced clone
CG12314 2003-01-01 Sim4 clustering to Release 3
CG12314 2008-04-29 Release 5.5 accounting
CG12314 2008-08-15 Release 5.9 accounting
CG12314 2008-12-18 5.12 accounting

Clone Sequence Records

LD05365.complete Sequence

1145 bp (1145 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118493

> LD05365.complete
ATTTAAAGCGCGCTAGAGAAACGAGCTAAATTCAAAAATGTTGATTACCC
AAATAATTATGAAACAAATTCGAGACTATCCCATTGTGTCCACAATAAGC
ATTGCCGTCAGCACTGTCCTGGCCTCAGAGGTGATTTGGAAGCTGGTGCA
GTGCTCGCGCAGCAAGCGAGAGAAGGCAAGCCGCGTGCACGAAGTGATCA
TCTTCAATGAACTGGGCGAGATCTGTGCGGCGGTGCATATGCGCAACAGC
AGCATGGGATCCCAGAAACCACAAGTGTCGCCCTGCTGCAACACGCATTG
TTCGCTGCGGAATGTGGCCAAGATCGTAGAGCAGATCGATCGGGCTGTAT
ACTCCATTGACCTGGCCATATACACCTTCACCTCGCTTTTTTTGGCGGAT
TCAATAAAGCGGGCCCTGCAGCGCGGCGTGATTATCCGGATCATCAGCGA
CGGGGAGATGGTCTACTCCAAAGGTTCTCAGATCAGTATGCTGGCACAAT
TGGGAGTTCCAGTTCGCGTCCCCATTACCACGAACTTGATGCACAACAAA
TTCTGCATAATCGACGGCTTCGAGCGCGTCGAGGAGATTCGTCTGCTGAG
GAAGCTCAAGTTTATGCGTCCGTGCTATAGCATCGTGATCAGCGGCTCCG
TAAACTGGACGGCTCTTGGACTGGGAGGCAATTGGGAGAACTGCATTATC
ACAGCTGACGACAAACTCACAGCCACGTTTCAGGCGGAATTCCAACGAAT
GTGGCGGGCTTTTGCGAAGACCGAGGGGAGCCAAATCCAGCTCAAGTAGA
AATCAATTGATTTAATGTATGACTACCAAACAGTTCCTCAGTATGCCAAA
TAATTATAGTTCTTATTTTCTAAGTGCCTTCAATTAAACTAAAACTTTTT
AAGGCAGCTTGATCTTCACACACAAAGGAGTGCCAAATTAATTAAGCAAA
ACAAAAGTAATCAAAATGTATACCTAACAGTATAATCCGTATGAAATCTT
TATCACTTCGATTGAGTTGACTAATTTTCAACGTGCATTTAGTTATGATC
AGCTTTGACTATATATATAACTTTCTACTTTATTCATCATGTTATTGAAA
GCTTTTAAGTAAATAAAAGTTAATTACAAAAAAAAAAAAAAAAAA

LD05365.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
zuc-RA 1127 zuc-RA 1..1127 1..1127 5635 100 Plus
CG34163-RA 576 CG34163-RA 417..576 1133..974 800 100 Minus
CG34163.a 484 CG34163.a 412..484 1133..1061 365 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11987388..11988514 1127..1 5620 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:51:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11988729..11989861 1133..1 5665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11988729..11989861 1133..1 5665 100 Minus
Blast to na_te.dros performed 2019-03-16 10:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT5 669 Dbuz\BuT5 BUT5 669bp 140..188 1120..1070 115 75 Minus

LD05365.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:14:07 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11987388..11988514 1..1127 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:36:49 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
CG12314-RA 1..762 38..799 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:07 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
zuc-RA 1..762 38..799 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:38:23 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
zuc-RA 1..762 38..799 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:41:38 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
CG12314-RA 1..762 38..799 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:00:12 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
zuc-RA 1..762 38..799 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:25:57 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
CG12314-RA 1..1127 1..1127 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:06 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
zuc-RA 1..1127 1..1127 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:23 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
zuc-RA 22..1148 1..1127 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:41:38 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
CG12314-RA 1..1127 1..1127 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:00:12 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
zuc-RA 22..1148 1..1127 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:07 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988735..11989861 1..1127 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:07 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988735..11989861 1..1127 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:07 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988735..11989861 1..1127 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:23 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11988735..11989861 1..1127 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:13:58 Download gff for LD05365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988735..11989861 1..1127 100   Minus

LD05365.hyp Sequence

Translation from 37 to 798

> LD05365.hyp
MLITQIIMKQIRDYPIVSTISIAVSTVLASEVIWKLVQCSRSKREKASRV
HEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTHCSLRNVAKIVEQI
DRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQIS
MLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIV
ISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGSQI
QLK*

LD05365.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
zuc-PA 253 CG12314-PA 1..253 1..253 1284 100 Plus

LD05365.pep Sequence

Translation from 37 to 798

> LD05365.pep
MLITQIIMKQIRDYPIVSTISIAVSTVLASEVIWKLVQCSRSKREKASRV
HEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTHCSLRNVAKIVEQI
DRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQIS
MLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIV
ISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGSQI
QLK*

LD05365.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14755-PA 279 GF14755-PA 2..217 20..239 544 52.3 Plus
Dana\GF20014-PA 259 GF20014-PA 1..245 2..245 433 39.4 Plus
Dana\GF13313-PA 266 GF13313-PA 52..243 42..242 273 31.4 Plus
Dana\GF18693-PA 233 GF18693-PA 52..216 71..241 251 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10288-PA 253 GG10288-PA 1..253 1..253 1052 77.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13819-PA 207 GH13819-PA 15..199 53..245 480 47.2 Plus
Dgri\GH20648-PA 249 GH20648-PA 31..236 33..242 368 38.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
zuc-PA 253 CG12314-PA 1..253 1..253 1284 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13482-PA 241 GI13482-PA 1..236 6..243 447 40.2 Plus
Dmoj\GI24814-PA 232 GI24814-PA 23..215 43..242 435 45.8 Plus
Dmoj\GI21822-PA 231 GI21822-PA 3..225 13..243 390 38.7 Plus
Dmoj\GI10739-PA 226 GI10739-PA 49..213 67..239 228 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19579-PA 240 GL19579-PA 3..236 7..242 605 52.9 Plus
Dper\GL13429-PA 420 GL13429-PA 1..80 123..202 185 51.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11550-PA 240 GA11550-PA 10..236 14..242 609 54.5 Plus
Dpse\GA13113-PA 420 GA13113-PA 1..80 123..202 165 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26473-PA 246 GM26473-PA 1..246 8..253 1177 88.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22146-PA 253 GD22146-PA 1..253 1..253 1208 88.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16996-PA 238 GJ16996-PA 1..238 7..246 469 40.5 Plus
Dvir\GJ20978-PA 300 GJ20978-PA 90..272 52..243 299 35 Plus
Dvir\GJ22526-PA 114 GJ22526-PA 1..102 141..242 293 51 Plus
Dvir\GJ10680-PA 164 GJ10680-PA 7..160 81..240 197 30.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19043-PA 253 GK19043-PA 6..246 7..248 595 48.8 Plus
Dwil\GK19590-PA 263 GK19590-PA 48..242 52..253 231 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12577-PA 246 GE12577-PA 1..246 8..253 1028 78 Plus