Clone LD05512 Report

Search the DGRC for LD05512

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:55
Well:12
Vector:pBS SK-
Associated Gene/Transcriptpr-RC
Protein status:LD05512.pep: gold
Preliminary Size:1213
Sequenced Size:1062

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16784 2001-01-01 Release 2 assignment
CG16784 2001-10-10 Blastp of sequenced clone
CG16784 2003-01-01 Sim4 clustering to Release 3
pr 2008-04-29 Release 5.5 accounting
pr 2008-08-15 Release 5.9 accounting
pr 2008-12-18 5.12 accounting

Clone Sequence Records

LD05512.complete Sequence

1062 bp (1062 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061078

> LD05512.complete
AACGTAGACAAAAGTAAATATTATTGAAAATCCATAGCAATTAAAGCACG
CATAGGCACTTGCAACAGAAAACGAGGGAACATCAATCGCTAATCAGCTG
CAATTAGCCGCACTCGAAAAGTTCAGAGAAACTAGTTCCGAGCGTGTTGA
TATCGCAGTCGCCGCATTTGTGGCTTATATTTCCTTGTTCCCTCGATCCA
AGTACCATATAAATAAGCGCGGCTCAAAAGCAGGTTTTGCATTCATTGTA
AAACATTGCCAAAGCGCGCAGCTGATCAGCCGCATATATAAATCCACATC
CAGATACAGATCCAGATATATAGTATAAATCGGACTTGAAATGTCGCAGC
AACCTGTTGCCTTTTTAACCCGTCGCGAAACTTTCAGCGCCTGCCATCGT
CTCCATAGTCCCCAATTGAGCGACGCCGAGAATCTGGAAGTCTTCGGCAA
GTGCAACAATTTCCACGGCCACGGACACAACTATACAGTTGAGATAACCG
TCCGTGGTCCCATCGATCGGCGAACCGGAATGGTGCTAAACATCACCGAG
CTGAAAGAGGCTATAGAAACTGTGATTATGAAGCGCCTGGACCACAAGAA
TCTCGATAAGGATGTCGAATACTTTGCCAATACACCAAGCACCACAGAAA
ACTTGGCCGTTTACATCTGGGACAACATCCGTCTGCAGCTGAAGAAGCCG
GAGCTGCTGTACGAGGTGAAGATCCATGAGACCCCAAAGAACATTATCAG
CTACCGCGGCCCGTATCCGCTCAATGGCATCTACAACCCCATCAACAAAC
GCATCGCTCACGATTCGTGCACCAACATCTCGTCGGATTCGGATTGAACA
TTCGAAGATTGTGACATCGCCTAACGAATTTTTTGATTGGACCAATGATC
AGCGAAGACTCAGCCAACCTCTTAAGCACGCGCGTAGAAAAGGACACTTA
CCATGTAAGGGAATGAAAAGTTATACGAATTACACAGTATGTAGGAGTAA
AATATGTTAATGCAACATAATATTGAATAAAACAAAGGCAACTGAAAAAA
AAAAAAAAAAAA

LD05512.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
pr-RC 1225 pr-RC 132..1178 1..1047 5235 100 Plus
pr-RB 906 pr-RB 1..904 144..1047 4520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20072087..20072496 1044..635 2005 99.3 Minus
chr2L 23010047 chr2L 20073327..20073690 408..45 1805 99.7 Minus
chr2L 23010047 chr2L 20072560..20072708 634..486 745 100 Minus
chr2L 23010047 chr2L 20073140..20073221 488..407 395 98.8 Minus
chr2L 23010047 chr2L 20073753..20073798 46..1 230 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20073716..20074128 1047..635 2065 100 Minus
2L 23513712 2L 20074958..20075321 408..45 1820 100 Minus
2L 23513712 2L 20074191..20074339 634..486 745 100 Minus
2L 23513712 2L 20074771..20074852 488..407 410 100 Minus
2L 23513712 2L 20075384..20075429 46..1 230 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20073716..20074128 1047..635 2065 100 Minus
2L 23513712 2L 20074958..20075321 408..45 1820 100 Minus
2L 23513712 2L 20074191..20074339 634..486 745 100 Minus
2L 23513712 2L 20074771..20074852 488..407 410 100 Minus
2L 23513712 2L 20075384..20075429 46..1 230 100 Minus
Blast to na_te.dros performed 2019-03-15 23:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 13118..13190 953..1027 126 66.7 Plus

LD05512.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:42:49 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20072087..20072496 635..1044 99 <- Minus
chr2L 20072560..20072705 489..634 100 <- Minus
chr2L 20073140..20073219 409..488 98 <- Minus
chr2L 20073327..20073688 47..408 99 <- Minus
chr2L 20073753..20073798 1..46 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:37:04 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RB 1..507 341..847 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:52 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 1..507 341..847 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:48 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 1..507 341..847 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:39 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RB 1..507 341..847 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:46:33 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 1..507 341..847 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:18 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 51..1094 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:51 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 39..1082 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:48 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 30..1073 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:39 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 51..1094 1..1044 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:46:33 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
pr-RC 30..1073 1..1044 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:49 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20074771..20074850 409..488 100 <- Minus
2L 20075384..20075429 1..46 100   Minus
2L 20074958..20075319 47..408 100 <- Minus
2L 20073719..20074128 635..1044 100 <- Minus
2L 20074191..20074336 489..634 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:49 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20074771..20074850 409..488 100 <- Minus
2L 20075384..20075429 1..46 100   Minus
2L 20074958..20075319 47..408 100 <- Minus
2L 20073719..20074128 635..1044 100 <- Minus
2L 20074191..20074336 489..634 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:42:49 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20074771..20074850 409..488 100 <- Minus
2L 20075384..20075429 1..46 100   Minus
2L 20074958..20075319 47..408 100 <- Minus
2L 20073719..20074128 635..1044 100 <- Minus
2L 20074191..20074336 489..634 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:48 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20073719..20074128 635..1044 100 <- Minus
arm_2L 20074191..20074336 489..634 100 <- Minus
arm_2L 20074771..20074850 409..488 100 <- Minus
arm_2L 20074958..20075319 47..408 100 <- Minus
arm_2L 20075384..20075429 1..46 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:34 Download gff for LD05512.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20073719..20074128 635..1044 100 <- Minus
2L 20074191..20074336 489..634 100 <- Minus
2L 20074771..20074850 409..488 100 <- Minus
2L 20074958..20075319 47..408 100 <- Minus
2L 20075384..20075429 1..46 100   Minus

LD05512.hyp Sequence

Translation from 340 to 846

> LD05512.hyp
MSQQPVAFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTV
EITVRGPIDRRTGMVLNITELKEAIETVIMKRLDHKNLDKDVEYFANTPS
TTENLAVYIWDNIRLQLKKPELLYEVKIHETPKNIISYRGPYPLNGIYNP
INKRIAHDSCTNISSDSD*

LD05512.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
pr-PC 168 CG16784-PC 1..168 1..168 895 100 Plus

LD05512.pep Sequence

Translation from 340 to 846

> LD05512.pep
MSQQPVAFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTV
EITVRGPIDRRTGMVLNITELKEAIETVIMKRLDHKNLDKDVEYFANTPS
TTENLAVYIWDNIRLQLKKPELLYEVKIHETPKNIISYRGPYPLNGIYNP
INKRIAHDSCTNISSDSD*

LD05512.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15457-PA 168 GF15457-PA 1..168 1..168 876 96.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21591-PA 168 GG21591-PA 1..168 1..168 885 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13241-PA 168 GH13241-PA 1..168 1..168 818 89.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
pr-PC 168 CG16784-PC 1..168 1..168 895 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12528-PA 168 GI12528-PA 1..168 1..168 828 90.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26673-PA 168 GL26673-PA 1..168 1..168 860 94.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29012-PA 168 GA29012-PA 1..168 1..168 860 94.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16965-PA 168 GM16965-PA 1..168 1..168 904 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17891-PA 168 GJ17891-PA 1..168 1..168 815 89.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18684-PA 168 GK18684-PA 1..168 1..168 882 97.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12609-PA 168 GE12609-PA 1..168 1..168 901 99.4 Plus