Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LD05675.complete Sequence
684 bp assembled on 2009-04-17
GenBank Submission: BT088443.1
> LD05675.complete
ATTTTTAATAAAAGATAATGAACACGTTAAAATACATTGATAATAAAGAA
ATAATAATTGAGATTCTTCATTTGGCTATAGATTACCTGATTGGAAATTT
TACTGACGAACAAACTCTTCGTTCGTCACACAAGTATGGATTTCAAAATT
CAGACGACTTTCTGTTGGTCATACGAATCGTGTCAAAGTTTTACAAGGAT
ATTTTAGTAAAATGCGAAAAACTAACTCAATTTTCGTGTATTAACCCTGA
AATGAGCCGGCATGCACATCTTGTGCTATCAGCACGCTATTCTGAGTTAA
GAAGCCATCTCGAGCATTGGGAGTTCTTGGAAAAAAAGAATGTCATAGAA
TCTTTTGGATGGGACACACGGCTAATATTAGGAGATAGCAGCTTTGGAAG
GCATATACATCAACTAACAACTTTGGTTTTCCAATACCGTCACATGCATA
TTCAAAAAGACTTGCATTTTGAAATGAATAACGTAATGTTAAGCGACTTC
ATTTATTTATTAGAAAATTTATTAGCCAGGTAACAATCCAAATATTAAAC
AAATATTATTGTTCTTAAAAATTCAGATTAATTGTATCTGGTAGAATATA
CAGATTTATATTTAAATATTGTTATTCATTTCTATCAAATTAATAAACTT
TTCTTTATATAGAACGAAAAAAAAAAAAAAAAAA
LD05675.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:30:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG40439-RA | 739 | CG40439-RA | 45..713 | 1..669 | 3345 | 100 | Plus |
CG40439.a | 939 | CG40439.a | 105..694 | 80..669 | 2950 | 100 | Plus |
CG40439-RB | 737 | CG40439-RB | 123..712 | 80..669 | 2950 | 100 | Plus |
CG40439.a | 939 | CG40439.a | 45..109 | 1..65 | 325 | 100 | Plus |
CG40439-RB | 737 | CG40439-RB | 63..127 | 1..65 | 325 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:16:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 22688745..22689350 | 666..61 | 3015 | 99.8 | Minus |
chr2L | 23010047 | chr2L | 22689400..22689461 | 62..1 | 310 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:16:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 854966..855574 | 61..669 | 3045 | 100 | Plus |
2L | 23513712 | 2L | 22797516..22798124 | 669..61 | 3045 | 100 | Minus |
2R | 25286936 | 2R | 854855..854916 | 1..62 | 310 | 100 | Plus |
2L | 23513712 | 2L | 22798174..22798235 | 62..1 | 310 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 22797516..22798124 | 669..61 | 3045 | 100 | Minus |
2R | 25260384 | 2R | 854966..855574 | 61..669 | 3045 | 100 | Plus |
2L | 23513712 | 2L | 22798174..22798235 | 62..1 | 310 | 100 | Minus |
2R | 25260384 | 2R | 854855..854916 | 1..62 | 310 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 04:16:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1030..1193 | 470..639 | 132 | 57.3 | Plus |
gypsy12 | 10218 | gypsy12 GYPSY12 10218bp | 1850..1924 | 578..651 | 129 | 67.1 | Plus |
gypsy12 | 10218 | gypsy12 GYPSY12 10218bp | 9732..9806 | 578..651 | 129 | 67.1 | Plus |
Stalker2 | 7672 | Stalker2 STALKER2 7672bp | 1304..1513 | 664..466 | 124 | 56.3 | Minus |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 6419..6473 | 9..65 | 109 | 68.4 | Plus |
LD05675.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:17:41 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 22688745..22689348 | 63..666 | 99 | <- | Minus |
chr2L | 22689400..22689461 | 1..62 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:43 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 1..516 | 18..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:58 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 1..516 | 18..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:30 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 1..516 | 18..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:34:18 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 1..516 | 18..533 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:20 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 1..666 | 1..666 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:57 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 1..666 | 1..666 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:30 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 42..707 | 1..666 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:34:18 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40439-RA | 42..707 | 1..666 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:41 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 854855..854916 | 1..62 | 100 | -> | Plus |
2R | 854968..855571 | 63..666 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:41 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 854855..854916 | 1..62 | 100 | -> | Plus |
2R | 854968..855571 | 63..666 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:41 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 854855..854916 | 1..62 | 100 | -> | Plus |
2R | 854968..855571 | 63..666 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:30 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 22690251..22690854 | 63..666 | 100 | <- | Minus |
arm_2L | 22690906..22690967 | 1..62 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:18 Download gff for
LD05675.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 854968..855571 | 63..666 | 100 | | Plus |
2R | 854855..854916 | 1..62 | 100 | -> | Plus |
LD05675.hyp Sequence
Translation from 17 to 532
> LD05675.hyp
MNTLKYIDNKEIIIEILHLAIDYLIGNFTDEQTLRSSHKYGFQNSDDFLL
VIRIVSKFYKDILVKCEKLTQFSCINPEMSRHAHLVLSARYSELRSHLEH
WEFLEKKNVIESFGWDTRLILGDSSFGRHIHQLTTLVFQYRHMHIQKDLH
FEMNNVMLSDFIYLLENLLAR*
LD05675.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG40439-PA | 171 | CG40439-PA | 1..171 | 1..171 | 895 | 100 | Plus |
CG40439-PB | 93 | CG40439-PB | 1..93 | 79..171 | 492 | 100 | Plus |
LD05675.pep Sequence
Translation from 17 to 532
> LD05675.pep
MNTLKYIDNKEIIIEILHLAIDYLIGNFTDEQTLRSSHKYGFQNSDDFLL
VIRIVSKFYKDILVKCEKLTQFSCINPEMSRHAHLVLSARYSELRSHLEH
WEFLEKKNVIESFGWDTRLILGDSSFGRHIHQLTTLVFQYRHMHIQKDLH
FEMNNVMLSDFIYLLENLLAR*
LD05675.pep Blast Records
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:38:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH13350-PA | 456 | GH13350-PA | 291..449 | 15..169 | 304 | 40.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG46302-PA | 171 | CG46302-PA | 1..171 | 1..171 | 895 | 100 | Plus |
CG40439-PA | 171 | CG40439-PA | 1..171 | 1..171 | 895 | 100 | Plus |
CG40439-PB | 93 | CG40439-PB | 1..93 | 79..171 | 492 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:38:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17516-PA | 535 | GJ17516-PA | 375..532 | 16..169 | 281 | 42.9 | Plus |