Clone LD05675 Report

Search the DGRC for LD05675

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:56
Well:75
Vector:pBS SK-
Associated Gene/TranscriptCG40439-RA
Protein status:LD05675.pep: gold
Preliminary Size:852
Sequenced Size:684

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG40439 2003-01-01 Sim4 clustering to Release 3
CG40439 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

LD05675.complete Sequence

684 bp assembled on 2009-04-17

GenBank Submission: BT088443.1

> LD05675.complete
ATTTTTAATAAAAGATAATGAACACGTTAAAATACATTGATAATAAAGAA
ATAATAATTGAGATTCTTCATTTGGCTATAGATTACCTGATTGGAAATTT
TACTGACGAACAAACTCTTCGTTCGTCACACAAGTATGGATTTCAAAATT
CAGACGACTTTCTGTTGGTCATACGAATCGTGTCAAAGTTTTACAAGGAT
ATTTTAGTAAAATGCGAAAAACTAACTCAATTTTCGTGTATTAACCCTGA
AATGAGCCGGCATGCACATCTTGTGCTATCAGCACGCTATTCTGAGTTAA
GAAGCCATCTCGAGCATTGGGAGTTCTTGGAAAAAAAGAATGTCATAGAA
TCTTTTGGATGGGACACACGGCTAATATTAGGAGATAGCAGCTTTGGAAG
GCATATACATCAACTAACAACTTTGGTTTTCCAATACCGTCACATGCATA
TTCAAAAAGACTTGCATTTTGAAATGAATAACGTAATGTTAAGCGACTTC
ATTTATTTATTAGAAAATTTATTAGCCAGGTAACAATCCAAATATTAAAC
AAATATTATTGTTCTTAAAAATTCAGATTAATTGTATCTGGTAGAATATA
CAGATTTATATTTAAATATTGTTATTCATTTCTATCAAATTAATAAACTT
TTCTTTATATAGAACGAAAAAAAAAAAAAAAAAA

LD05675.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG40439-RA 739 CG40439-RA 45..713 1..669 3345 100 Plus
CG40439.a 939 CG40439.a 105..694 80..669 2950 100 Plus
CG40439-RB 737 CG40439-RB 123..712 80..669 2950 100 Plus
CG40439.a 939 CG40439.a 45..109 1..65 325 100 Plus
CG40439-RB 737 CG40439-RB 63..127 1..65 325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22688745..22689350 666..61 3015 99.8 Minus
chr2L 23010047 chr2L 22689400..22689461 62..1 310 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 854966..855574 61..669 3045 100 Plus
2L 23513712 2L 22797516..22798124 669..61 3045 100 Minus
2R 25286936 2R 854855..854916 1..62 310 100 Plus
2L 23513712 2L 22798174..22798235 62..1 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22797516..22798124 669..61 3045 100 Minus
2R 25260384 2R 854966..855574 61..669 3045 100 Plus
2L 23513712 2L 22798174..22798235 62..1 310 100 Minus
2R 25260384 2R 854855..854916 1..62 310 100 Plus
Blast to na_te.dros performed 2019-03-16 04:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1030..1193 470..639 132 57.3 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 1850..1924 578..651 129 67.1 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9732..9806 578..651 129 67.1 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 1304..1513 664..466 124 56.3 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 6419..6473 9..65 109 68.4 Plus

LD05675.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:17:41 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22688745..22689348 63..666 99 <- Minus
chr2L 22689400..22689461 1..62 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:43 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 1..516 18..533 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:58 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 1..516 18..533 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:30 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 1..516 18..533 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:34:18 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 1..516 18..533 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:20 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 1..666 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:57 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 1..666 1..666 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:30 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 42..707 1..666 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:34:18 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
CG40439-RA 42..707 1..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:41 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 854855..854916 1..62 100 -> Plus
2R 854968..855571 63..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:41 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 854855..854916 1..62 100 -> Plus
2R 854968..855571 63..666 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:41 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 854855..854916 1..62 100 -> Plus
2R 854968..855571 63..666 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:30 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22690251..22690854 63..666 100 <- Minus
arm_2L 22690906..22690967 1..62 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:18 Download gff for LD05675.complete
Subject Subject Range Query Range Percent Splice Strand
2R 854968..855571 63..666 100   Plus
2R 854855..854916 1..62 100 -> Plus

LD05675.hyp Sequence

Translation from 17 to 532

> LD05675.hyp
MNTLKYIDNKEIIIEILHLAIDYLIGNFTDEQTLRSSHKYGFQNSDDFLL
VIRIVSKFYKDILVKCEKLTQFSCINPEMSRHAHLVLSARYSELRSHLEH
WEFLEKKNVIESFGWDTRLILGDSSFGRHIHQLTTLVFQYRHMHIQKDLH
FEMNNVMLSDFIYLLENLLAR*

LD05675.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG40439-PA 171 CG40439-PA 1..171 1..171 895 100 Plus
CG40439-PB 93 CG40439-PB 1..93 79..171 492 100 Plus

LD05675.pep Sequence

Translation from 17 to 532

> LD05675.pep
MNTLKYIDNKEIIIEILHLAIDYLIGNFTDEQTLRSSHKYGFQNSDDFLL
VIRIVSKFYKDILVKCEKLTQFSCINPEMSRHAHLVLSARYSELRSHLEH
WEFLEKKNVIESFGWDTRLILGDSSFGRHIHQLTTLVFQYRHMHIQKDLH
FEMNNVMLSDFIYLLENLLAR*

LD05675.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13350-PA 456 GH13350-PA 291..449 15..169 304 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG46302-PA 171 CG46302-PA 1..171 1..171 895 100 Plus
CG40439-PA 171 CG40439-PA 1..171 1..171 895 100 Plus
CG40439-PB 93 CG40439-PB 1..93 79..171 492 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17516-PA 535 GJ17516-PA 375..532 16..169 281 42.9 Plus