BDGP Sequence Production Resources |
Search the DGRC for LD05688
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 56 |
Well: | 88 |
Vector: | pBS SK- |
Associated Gene/Transcript | Tom-RA |
Protein status: | LD05688.pep: gold |
Preliminary Size: | 1144 |
Sequenced Size: | 963 |
Gene | Date | Evidence |
---|---|---|
CG5185 | 2001-01-01 | Release 2 assignment |
CG5185 | 2001-07-04 | Blastp of sequenced clone |
CG5185 | 2003-01-01 | Sim4 clustering to Release 3 |
Tom | 2008-04-29 | Release 5.5 accounting |
Tom | 2008-08-15 | Release 5.9 accounting |
Tom | 2008-12-18 | 5.12 accounting |
963 bp (963 high quality bases) assembled on 2001-07-04
GenBank Submission: AY060362
> LD05688.complete TCTCAACCGAGTGCAACCAACTAAGATCCCAAGTTTTATTATAAATCTCA ACAATCCTCAACACAATGTCGTTCATCACACGGGAATACAAGTTTGAGAG CAGCAAGGTGATGGAGCCGAAATCAGATCAGCACACGATGGCCATGCGGA GTCTGAGGAAACTGGTCAAACCCCTTCTGCGACTGGTGAAGAAGAAGCAG CTACTCCGGAAGACTCTGGCCGAGATCCAGAACCAAAATGCAGTCAACGC CTCGCTGGAGGACATGCGCAAAGATCCGGCGGCCAGTTGCGATAACATGG CCAACGAGGAGCTGGAGCAGCGACTGTACACCGATCTCCGCCAGTGCCCC ACCAACGTGGCCATGATCGTGCAGCAGGGTCAGCAACAGAGCATCGTGCC CGTCCATCCGGAGCAGACCTTCATCCCGGTCCACTTCGCCCGCACCACCA GCGGCACCTTCTTCTGGACCTCAGCCGAGGGAGCTCGCCAGCACCACGAA CAGCAGTTGCGCCAGCAGTTCGACCGTTGGGTTCAGGCCTAAACATCGCC AGGATGCACAGTTCCACTTCTCGATGCACCGGGAAAAACTCCAATTGGCA GCTTTAAGTGCAAGTGTCTCCGTCCATTGGTCGTCGGATGGATGCGGGTT CAGCTTCGCATGTTCGTAATCTCAGGGTGATATTAGGCATAGATTGGATT CTTTGGGCTCGCGTCCCAAGGGAAACACAACTCTAATTGATATTCAATTA TCACAATCAAGCGTTACTATCGTTAACTCATTGTGATTTATCGTGTCTTA TTAGCCTTAAGTTAGTCTTAGCCGAATCATTGTCTTCCATGTTTGTTTGT TAGGGTCTTCGTATAAGAATTAGGCTAAGAATCATTGTCTTCCATGTAAA ACTTTAGCTATAAACACTAATATCATATAAGAAATAAATAAATCGAAAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tom-RA | 971 | Tom-RA | 16..966 | 1..951 | 4755 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 14959432..14960376 | 1..945 | 4680 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 14969362..14970312 | 1..951 | 4755 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 14962462..14963412 | 1..951 | 4755 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 55..102 | 901..945 | 115 | 77.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 14959432..14960376 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 1..477 | 66..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 1..477 | 66..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 1..477 | 66..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 1..477 | 66..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 1..477 | 66..542 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 16..960 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 16..960 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 19..963 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 16..960 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom-RA | 19..963 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14969362..14970306 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14969362..14970306 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14969362..14970306 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 14962462..14963406 | 1..945 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 14962462..14963406 | 1..945 | 100 | Plus |
Translation from 65 to 541
> LD05688.pep MSFITREYKFESSKVMEPKSDQHTMAMRSLRKLVKPLLRLVKKKQLLRKT LAEIQNQNAVNASLEDMRKDPAASCDNMANEELEQRLYTDLRQCPTNVAM IVQQGQQQSIVPVHPEQTFIPVHFARTTSGTFFWTSAEGARQHHEQQLRQ QFDRWVQA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24624-PA | 158 | GF24624-PA | 1..158 | 1..158 | 710 | 89.2 | Plus |
Dana\GF24626-PA | 149 | GF24626-PA | 22..149 | 28..158 | 188 | 36 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15703-PA | 158 | GG15703-PA | 1..158 | 1..158 | 845 | 99.4 | Plus |
Dere\GG15705-PA | 226 | GG15705-PA | 99..226 | 28..158 | 186 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14633-PA | 159 | GH14633-PA | 1..159 | 1..158 | 664 | 76.7 | Plus |
Dgri\GH14634-PA | 158 | GH14634-PA | 1..158 | 1..158 | 178 | 32.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tom-PA | 158 | CG5185-PA | 1..158 | 1..158 | 815 | 100 | Plus |
Ocho-PB | 149 | CG3396-PB | 22..149 | 28..158 | 180 | 37 | Plus |
Ocho-PC | 149 | CG3396-PC | 22..149 | 28..158 | 180 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11346-PA | 163 | GI11346-PA | 1..163 | 1..158 | 621 | 71.2 | Plus |
Dmoj\GI11347-PA | 162 | GI11347-PA | 34..162 | 28..158 | 193 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24642-PA | 157 | GL24642-PA | 1..157 | 1..158 | 636 | 88.6 | Plus |
Dper\GL24664-PA | 150 | GL24664-PA | 1..150 | 1..158 | 188 | 35.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18719-PA | 157 | GA18719-PA | 1..157 | 1..158 | 636 | 88.6 | Plus |
Dpse\GA17423-PA | 151 | GA17423-PA | 1..151 | 1..158 | 196 | 35.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25490-PA | 158 | GM25490-PA | 1..158 | 1..158 | 848 | 100 | Plus |
Dsec\GM25493-PA | 149 | GM25493-PA | 22..149 | 28..158 | 184 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14510-PA | 59 | GD14510-PA | 1..59 | 100..158 | 304 | 96.6 | Plus |
Dsim\GD14509-PA | 64 | GD14509-PA | 1..64 | 1..73 | 283 | 79.5 | Plus |
Dsim\GD14513-PA | 149 | GD14513-PA | 22..149 | 28..158 | 184 | 37.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11599-PA | 159 | GJ11599-PA | 1..159 | 1..158 | 639 | 76.1 | Plus |
Dvir\GJ11601-PA | 160 | GJ11601-PA | 33..160 | 28..158 | 168 | 35 | Plus |
Translation from 65 to 541
> LD05688.hyp MSFITREYKFESSKVMEPKSDQHTMAMRSLRKLVKPLLRLVKKKQLLRKT LAEIQNQNAVNASLEDMRKDPAASCDNMANEELEQRLYTDLRQCPTNVAM IVQQGQQQSIVPVHPEQTFIPVHFARTTSGTFFWTSAEGARQHHEQQLRQ QFDRWVQA*