Clone LD05688 Report

Search the DGRC for LD05688

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:56
Well:88
Vector:pBS SK-
Associated Gene/TranscriptTom-RA
Protein status:LD05688.pep: gold
Preliminary Size:1144
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5185 2001-01-01 Release 2 assignment
CG5185 2001-07-04 Blastp of sequenced clone
CG5185 2003-01-01 Sim4 clustering to Release 3
Tom 2008-04-29 Release 5.5 accounting
Tom 2008-08-15 Release 5.9 accounting
Tom 2008-12-18 5.12 accounting

Clone Sequence Records

LD05688.complete Sequence

963 bp (963 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060362

> LD05688.complete
TCTCAACCGAGTGCAACCAACTAAGATCCCAAGTTTTATTATAAATCTCA
ACAATCCTCAACACAATGTCGTTCATCACACGGGAATACAAGTTTGAGAG
CAGCAAGGTGATGGAGCCGAAATCAGATCAGCACACGATGGCCATGCGGA
GTCTGAGGAAACTGGTCAAACCCCTTCTGCGACTGGTGAAGAAGAAGCAG
CTACTCCGGAAGACTCTGGCCGAGATCCAGAACCAAAATGCAGTCAACGC
CTCGCTGGAGGACATGCGCAAAGATCCGGCGGCCAGTTGCGATAACATGG
CCAACGAGGAGCTGGAGCAGCGACTGTACACCGATCTCCGCCAGTGCCCC
ACCAACGTGGCCATGATCGTGCAGCAGGGTCAGCAACAGAGCATCGTGCC
CGTCCATCCGGAGCAGACCTTCATCCCGGTCCACTTCGCCCGCACCACCA
GCGGCACCTTCTTCTGGACCTCAGCCGAGGGAGCTCGCCAGCACCACGAA
CAGCAGTTGCGCCAGCAGTTCGACCGTTGGGTTCAGGCCTAAACATCGCC
AGGATGCACAGTTCCACTTCTCGATGCACCGGGAAAAACTCCAATTGGCA
GCTTTAAGTGCAAGTGTCTCCGTCCATTGGTCGTCGGATGGATGCGGGTT
CAGCTTCGCATGTTCGTAATCTCAGGGTGATATTAGGCATAGATTGGATT
CTTTGGGCTCGCGTCCCAAGGGAAACACAACTCTAATTGATATTCAATTA
TCACAATCAAGCGTTACTATCGTTAACTCATTGTGATTTATCGTGTCTTA
TTAGCCTTAAGTTAGTCTTAGCCGAATCATTGTCTTCCATGTTTGTTTGT
TAGGGTCTTCGTATAAGAATTAGGCTAAGAATCATTGTCTTCCATGTAAA
ACTTTAGCTATAAACACTAATATCATATAAGAAATAAATAAATCGAAAAA
AAAAAAAAAAAAA

LD05688.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tom-RA 971 Tom-RA 16..966 1..951 4755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14959432..14960376 1..945 4680 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14969362..14970312 1..951 4755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14962462..14963412 1..951 4755 100 Plus
Blast to na_te.dros performed 2019-03-16 04:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 55..102 901..945 115 77.1 Plus

LD05688.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:03:22 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14959432..14960376 1..945 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:37:33 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:19:38 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:43 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:51:13 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:00 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 1..477 66..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:15:40 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 16..960 1..945 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:19:38 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 16..960 1..945 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:43 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 19..963 1..945 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:51:13 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 16..960 1..945 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:00 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
Tom-RA 19..963 1..945 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:22 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14969362..14970306 1..945 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:22 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14969362..14970306 1..945 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:22 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14969362..14970306 1..945 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:43 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14962462..14963406 1..945 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:29:39 Download gff for LD05688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14962462..14963406 1..945 100   Plus

LD05688.pep Sequence

Translation from 65 to 541

> LD05688.pep
MSFITREYKFESSKVMEPKSDQHTMAMRSLRKLVKPLLRLVKKKQLLRKT
LAEIQNQNAVNASLEDMRKDPAASCDNMANEELEQRLYTDLRQCPTNVAM
IVQQGQQQSIVPVHPEQTFIPVHFARTTSGTFFWTSAEGARQHHEQQLRQ
QFDRWVQA*

LD05688.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24624-PA 158 GF24624-PA 1..158 1..158 710 89.2 Plus
Dana\GF24626-PA 149 GF24626-PA 22..149 28..158 188 36 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15703-PA 158 GG15703-PA 1..158 1..158 845 99.4 Plus
Dere\GG15705-PA 226 GG15705-PA 99..226 28..158 186 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14633-PA 159 GH14633-PA 1..159 1..158 664 76.7 Plus
Dgri\GH14634-PA 158 GH14634-PA 1..158 1..158 178 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tom-PA 158 CG5185-PA 1..158 1..158 815 100 Plus
Ocho-PB 149 CG3396-PB 22..149 28..158 180 37 Plus
Ocho-PC 149 CG3396-PC 22..149 28..158 180 37 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11346-PA 163 GI11346-PA 1..163 1..158 621 71.2 Plus
Dmoj\GI11347-PA 162 GI11347-PA 34..162 28..158 193 36.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24642-PA 157 GL24642-PA 1..157 1..158 636 88.6 Plus
Dper\GL24664-PA 150 GL24664-PA 1..150 1..158 188 35.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18719-PA 157 GA18719-PA 1..157 1..158 636 88.6 Plus
Dpse\GA17423-PA 151 GA17423-PA 1..151 1..158 196 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25490-PA 158 GM25490-PA 1..158 1..158 848 100 Plus
Dsec\GM25493-PA 149 GM25493-PA 22..149 28..158 184 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14510-PA 59 GD14510-PA 1..59 100..158 304 96.6 Plus
Dsim\GD14509-PA 64 GD14509-PA 1..64 1..73 283 79.5 Plus
Dsim\GD14513-PA 149 GD14513-PA 22..149 28..158 184 37.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11599-PA 159 GJ11599-PA 1..159 1..158 639 76.1 Plus
Dvir\GJ11601-PA 160 GJ11601-PA 33..160 28..158 168 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10544-PA 154 GK10544-PA 1..154 1..158 617 77.2 Plus
Dwil\GK19004-PA 149 GK19004-PA 21..149 28..158 164 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22035-PA 158 GE22035-PA 1..158 1..158 848 100 Plus
Dyak\GE22037-PA 149 GE22037-PA 22..149 28..158 184 37.5 Plus

LD05688.hyp Sequence

Translation from 65 to 541

> LD05688.hyp
MSFITREYKFESSKVMEPKSDQHTMAMRSLRKLVKPLLRLVKKKQLLRKT
LAEIQNQNAVNASLEDMRKDPAASCDNMANEELEQRLYTDLRQCPTNVAM
IVQQGQQQSIVPVHPEQTFIPVHFARTTSGTFFWTSAEGARQHHEQQLRQ
QFDRWVQA*

LD05688.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
Tom-PA 158 CG5185-PA 1..158 1..158 815 100 Plus
Ocho-PB 149 CG3396-PB 22..149 28..158 180 37 Plus
Ocho-PC 149 CG3396-PC 22..149 28..158 180 37 Plus