Clone LD05707 Report

Search the DGRC for LD05707

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:57
Well:7
Vector:pBS SK-
Associated Gene/TranscriptNaam-RA
Protein status:LD05707.pep: gold
Preliminary Size:1898
Sequenced Size:1817

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7444 2001-01-01 Release 2 assignment
CG7500 2001-01-01 Release 2 assignment
CG31216 2002-05-30 Blastp of sequenced clone
CG31216 2003-01-01 Sim4 clustering to Release 3
CG31216 2008-04-29 Release 5.5 accounting
CG31216 2008-08-15 Release 5.9 accounting
CG31216 2008-12-18 5.12 accounting

Clone Sequence Records

LD05707.complete Sequence

1817 bp (1817 high quality bases) assembled on 2002-05-30

GenBank Submission: AY122151

> LD05707.complete
AGCTGACGGACGCGAATTGTTCCCTCCAACCGGCGAGTTCTTTAAGTTTC
TCGGGAATGTTTGTATTATCTCAAAAAATTGACTACATCAACGAATTCTA
AGTGGTATAATTACAGTTTGTGCTTGCTGTGAAGATTTACAGCTCGAATA
AATCATAATATTGTACAATTAACGCTGATAATCACGAATTTGACATTGCT
ACCACATTCGGTGCGTGGACTCTGAAAGCTCTGAGTGTTTTGTTTATGCA
AAGCTTTTTTGGACTATCGCGTGCTGGCTGCGGGAGCTTCATTAAGTGAG
AGTTCGCTGCTGGATTCGTTGGCTTTGTTTGGACGTTGGCAACATCGTCG
CCGTTATGGATTCACCTACACCGCCAATTGTCATCGAAGATTCAAACGGA
TCAGCAATGGACGCCTGTTTCACGGCATTCGACAAGGACAGTGATGACCG
CCTGAGTCTTGCCGAATTTTCGATAATCTGTCGAGCTCTGTTCCGCAACG
ACAAGGGACACATCTACGATGTGCCCCCCGAGCGCCTTGAGCAGATATTC
GCCGTCTTCGATACGAATGGCGATGGCTTCATCGACCGGGAGGAGTTTAA
ATTCTGTTGGAACCAGTGGATAAAAACGATTGTGCGACCGGTGAACGCGT
TCCTCATTGTTGATGTACAAAATGATTTTATAAGTGGTTCCTTGGATATA
AGTAATTGCAGTGCACAGCAGCAAGGACACGAGATACTGGAGCCCATCAA
CAAGCTGCTGGATACGGTGGACTTTGATGCCGTCTTCTACTCATTGGACT
GGCATCCCAGCGATCACGTTTCATTTATTGATAATGTCAAAATGCGCCCC
ATGGACGAGTCCTCCGCGTTGGACTCGGATTCCGCCAAGGTGTTTGACAC
GGTCATTTTCGCAGGACCGCCGCCGATGAAGCAGCGCCTGTGGCCACGTC
ACTGCGTCCAGGACTCGTGGGGAGCCGAGCTGCACAAGGACCTCAAAGTG
GTCGACCACGGCATCAAGGTGTACAAGGGCACTAATCCCGAGGTGGACTC
TTATTCGGTGTTCTGGGACAACAAGAAGCTATCTGACACCACTCTAAATG
CCCAGCTGAAAATGAAGGGCGCCACGGATATCTATGTGTGCGGATTGGCC
TATGACGTCTGCGTTGGAGCCACAGCCGTGGATGCTTTGTCCGCCGGATA
CAGGACCATCCTCATCGACGACTGCTGCCGGGGTACAGATGTCCACGACA
TCGAGCACACCAAGGAGAAGGTCAACACCAGCGATGGCGTTATAGTCCAC
ACTAATCAGGTCAAGGCAATGGCCGAGGGTCGGGATCGTCGTCCTGAACT
GGGCTACAAACTGGCCATGGAGCTGAAGAGCCCCGATTCGGTTCTTTCGC
AACGCAATGGCTTCAGGCCCTCATACTAAATGCGAGAGGCAACTAAATCA
CGCTAGGCTTATTTTCATGGATATAAAAAGACAAAAGGCTTTTGTGTAGT
CGACGGTTAGATCGTTTCGATTAGATTAGTTTAGATCACCTGTGAAGTGC
CTCTGTAGTTTGGCTAGCTTTTGCTAAAAATATTCTAGAATTGGTAAAAT
CTTTTTTAAGCCTGTTATCCATGTGGATTTTACATGACATTACAATACTA
ACAACAATCGAAAACGAAAAGTGCAAAGTTCTTGCCTACGGAGATATTGA
GGTAAATAAAATGTCGTTTAAGTATTACCGAGCTCTCTCTATAACCCAAG
CACCATAAAATACAATTCCAACAGCAATAAAGTACTAAGGGTTCTTAAAA
AAAAAAAAAAAAAAAAA

LD05707.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31216-RA 2027 CG31216-RA 40..1837 1..1798 8990 100 Plus
CG31216.a 1919 CG31216.a 78..1759 117..1798 8410 100 Plus
CG31216.c 1790 CG31216.c 76..1600 274..1798 7625 100 Plus
CG31216.a 1919 CG31216.a 20..77 1..58 290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15521904..15522392 1308..1796 2445 100 Plus
chr3R 27901430 chr3R 15521368..15521811 868..1311 2220 100 Plus
chr3R 27901430 chr3R 15495300..15495572 1..273 1365 100 Plus
chr3R 27901430 chr3R 15512019..15512208 439..628 950 100 Plus
chr3R 27901430 chr3R 15510972..15511140 273..441 845 100 Plus
chr3R 27901430 chr3R 15521153..15521289 732..868 685 100 Plus
chr3R 27901430 chr3R 15520394..15520499 628..733 530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19698062..19698552 1308..1798 2455 100 Plus
3R 32079331 3R 19697525..19697968 868..1311 2220 100 Plus
3R 32079331 3R 19671471..19671743 1..273 1365 100 Plus
3R 32079331 3R 19688176..19688365 439..628 950 100 Plus
3R 32079331 3R 19687129..19687297 273..441 845 100 Plus
3R 32079331 3R 19697310..19697446 732..868 685 100 Plus
3R 32079331 3R 19696551..19696656 628..733 530 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19438893..19439383 1308..1798 2455 100 Plus
3R 31820162 3R 19438356..19438799 868..1311 2220 100 Plus
3R 31820162 3R 19412302..19412574 1..273 1365 100 Plus
3R 31820162 3R 19429007..19429196 439..628 950 100 Plus
3R 31820162 3R 19427960..19428128 273..441 845 100 Plus
3R 31820162 3R 19438141..19438277 732..868 685 100 Plus
3R 31820162 3R 19437382..19437487 628..733 530 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:55:24 has no hits.

LD05707.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:32 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15495300..15495572 1..273 100 -> Plus
chr3R 15510973..15511140 274..441 100 -> Plus
chr3R 15512022..15512208 442..628 100 -> Plus
chr3R 15520395..15520499 629..733 100 -> Plus
chr3R 15521155..15521289 734..868 100 -> Plus
chr3R 15521369..15521809 869..1309 100 -> Plus
chr3R 15521906..15522392 1310..1796 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:33:36 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
CG31216-RA 1..1074 356..1429 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:37:15 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
Naam-RA 1..1074 356..1429 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:52 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
Naam-RA 1..1074 356..1429 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:51 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
CG31216-RA 1..1074 356..1429 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:40 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
Naam-RA 1..1074 356..1429 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:33:35 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
CG31216-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:37:15 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
Naam-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:52 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
Naam-RA 22..1817 1..1796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:51 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
CG31216-RA 11..1806 1..1796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:40 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
Naam-RA 22..1817 1..1796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:32 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19671471..19671743 1..273 100 -> Plus
3R 19687130..19687297 274..441 100 -> Plus
3R 19688179..19688365 442..628 100 -> Plus
3R 19696552..19696656 629..733 100 -> Plus
3R 19697312..19697446 734..868 100 -> Plus
3R 19697526..19697966 869..1309 100 -> Plus
3R 19698064..19698550 1310..1796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:32 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19671471..19671743 1..273 100 -> Plus
3R 19687130..19687297 274..441 100 -> Plus
3R 19688179..19688365 442..628 100 -> Plus
3R 19696552..19696656 629..733 100 -> Plus
3R 19697312..19697446 734..868 100 -> Plus
3R 19697526..19697966 869..1309 100 -> Plus
3R 19698064..19698550 1310..1796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:32 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19671471..19671743 1..273 100 -> Plus
3R 19687130..19687297 274..441 100 -> Plus
3R 19688179..19688365 442..628 100 -> Plus
3R 19696552..19696656 629..733 100 -> Plus
3R 19697312..19697446 734..868 100 -> Plus
3R 19697526..19697966 869..1309 100 -> Plus
3R 19698064..19698550 1310..1796 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:52 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15497193..15497465 1..273 100 -> Plus
arm_3R 15512852..15513019 274..441 100 -> Plus
arm_3R 15513901..15514087 442..628 100 -> Plus
arm_3R 15522274..15522378 629..733 100 -> Plus
arm_3R 15523034..15523168 734..868 100 -> Plus
arm_3R 15523248..15523688 869..1309 100 -> Plus
arm_3R 15523786..15524272 1310..1796 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:27 Download gff for LD05707.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19412302..19412574 1..273 100 -> Plus
3R 19427961..19428128 274..441 100 -> Plus
3R 19429010..19429196 442..628 100 -> Plus
3R 19437383..19437487 629..733 100 -> Plus
3R 19438143..19438277 734..868 100 -> Plus
3R 19438357..19438797 869..1309 100 -> Plus
3R 19438895..19439381 1310..1796 100   Plus

LD05707.pep Sequence

Translation from 355 to 1428

> LD05707.pep
MDSPTPPIVIEDSNGSAMDACFTAFDKDSDDRLSLAEFSIICRALFRNDK
GHIYDVPPERLEQIFAVFDTNGDGFIDREEFKFCWNQWIKTIVRPVNAFL
IVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWH
PSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHC
VQDSWGAELHKDLKVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQ
LKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIE
HTKEKVNTSDGVIVHTNQVKAMAEGRDRRPELGYKLAMELKSPDSVLSQR
NGFRPSY*

LD05707.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17613-PA 394 GF17613-PA 1..394 1..357 1824 88.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23460-PA 357 GG23460-PA 1..357 1..357 1894 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15190-PA 357 GH15190-PA 1..357 1..357 1841 95.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Naam-PB 357 CG31216-PB 1..357 1..357 1907 100 Plus
Naam-PA 357 CG31216-PA 1..357 1..357 1907 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22421-PA 357 GI22421-PA 1..357 1..357 1843 95.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12667-PA 406 GL12667-PA 1..406 1..357 1794 84.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27584-PA 341 GA27584-PA 2..341 18..357 1763 96.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26858-PA 357 GM26858-PA 1..357 1..357 1889 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19309-PA 357 GD19309-PA 1..357 1..357 1903 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10980-PA 357 GJ10980-PA 1..357 1..357 1851 96.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22349-PA 357 GK22349-PA 1..357 1..357 1862 96.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25621-PA 357 GE25621-PA 1..357 1..357 1903 99.2 Plus

LD05707.hyp Sequence

Translation from 355 to 1428

> LD05707.hyp
MDSPTPPIVIEDSNGSAMDACFTAFDKDSDDRLSLAEFSIICRALFRNDK
GHIYDVPPERLEQIFAVFDTNGDGFIDREEFKFCWNQWIKTIVRPVNAFL
IVDVQNDFISGSLDISNCSAQQQGHEILEPINKLLDTVDFDAVFYSLDWH
PSDHVSFIDNVKMRPMDESSALDSDSAKVFDTVIFAGPPPMKQRLWPRHC
VQDSWGAELHKDLKVVDHGIKVYKGTNPEVDSYSVFWDNKKLSDTTLNAQ
LKMKGATDIYVCGLAYDVCVGATAVDALSAGYRTILIDDCCRGTDVHDIE
HTKEKVNTSDGVIVHTNQVKAMAEGRDRRPELGYKLAMELKSPDSVLSQR
NGFRPSY*

LD05707.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Naam-PB 357 CG31216-PB 1..357 1..357 1907 100 Plus
Naam-PA 357 CG31216-PA 1..357 1..357 1907 100 Plus