Clone LD05816 Report

Search the DGRC for LD05816

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:58
Well:16
Vector:pBS SK-
Associated Gene/TranscriptAtg8a-RA
Protein status:LD05816.pep: gold
Preliminary Size:1296
Sequenced Size:1085

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32672 2002-06-13 Blastp of sequenced clone
Atg8a 2008-04-29 Release 5.5 accounting
Atg8a 2008-08-15 Release 5.9 accounting
Atg8a 2008-12-18 5.12 accounting

Clone Sequence Records

LD05816.complete Sequence

1085 bp (1085 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122152

> LD05816.complete
AGAAAACAGAGAAGAGAAAAACACAAGCTCAGCAACGCATCGATATTCGG
CACAGTCCCAAAAGCAAACGAAGTGATAGAAGCTGCGTTTCTTAGCCAAT
TACCTCTTCATTGCAATCATGAAGTTCCAATACAAGGAGGAGCACGCCTT
CGAGAAGCGTCGCGCCGAGGGCGACAAGATCCGTCGCAAATATCCAGACC
GTGTGCCCGTCATCGTCGAGAAGGCTCCCAAGGCGCGCATCGGTGATTTG
GACAAGAAGAAGTACCTGGTGCCTTCCGACCTGACCGTCGGTCAGTTCTA
CTTCCTCATTCGCAAGCGCATCCACCTGCGTCCCGAGGATGCCCTCTTCT
TCTTTGTGAACAACGTCATTCCACCAACATCGGCTACCATGGGCTCCCTG
TACCAGGAACATCACGAGGAGGACTATTTCCTGTACATTGCCTACTCCGA
TGAGAATGTTTACGGCATGGCCAAAATTAACTAACTTTGCTCCGGTCGGG
ATGCATCGGAATGAAGCCCCCCCCCTATACAGAAATCTATATATAAATAA
AATATATTTTGTGTTTAGCATGCAAGCTTACAACATGGACGGCGAGTTAG
CTAAACGAATTGAGGAAAACCGCAGGAAATGCCACATGAAAAGAACTTGA
AATTGATCTGATACGCAGGGCAACAAAAAAAATCCACAAAAACCGAAAAC
TACAAAAACAATTGTTATGTGAACATTATTTTATATATATACATTTTCCA
AACGCGTTAGTATTTCAATTAAACTCTGCTTTGTGTCCTACCCATTAACG
AAACAACCAACCAACCAACTTTCCCCACAAAAAACAGATCTATTCACACC
CTTTCTGGGCCATTTAATTTCCATTGCTGTAATTGATCCGTGCGAATGCT
TTGTACTTTACTTTGTTACTTTGCTAATATTTCAATGAATTCACTATTTT
TTTTTTTATTCACGATGCAACAAAATTCTGTGCATATTTAGTGTGTATGG
TTACGAATAGGACTCTCTCGGTTAAGTGTACGGTAATTAATCTATTATTA
AATAAACAAAAACCAAAAAAAAAAAAAAAAAAAAA

LD05816.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1421 Atg8a-RA 280..1350 1..1071 5325 99.8 Plus
Atg8b-RA 621 Atg8b-RA 141..478 119..456 775 81.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10656241..10656900 1064..405 3285 99.8 Minus
chrX 22417052 chrX 10659342..10659551 210..1 1050 100 Minus
chrX 22417052 chrX 10656967..10657165 407..209 995 100 Minus
chr3R 27901430 chr3R 13548913..13549250 456..119 775 82 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10764871..10765537 1071..405 3305 99.7 Minus
X 23542271 X 10767979..10768188 210..1 1050 100 Minus
X 23542271 X 10765604..10765802 407..209 995 100 Minus
3R 32079331 3R 17724567..17724904 456..119 775 82 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10772969..10773635 1071..405 3305 99.7 Minus
X 23527363 X 10776077..10776286 210..1 1050 100 Minus
X 23527363 X 10773702..10773900 407..209 995 100 Minus
3R 31820162 3R 17465398..17465735 456..119 775 81.9 Minus
Blast to na_te.dros performed 2019-03-15 13:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3918..3962 747..704 123 77.8 Minus
Dbuz\BuT1 769 Dbuz\BuT1 BUT1 769bp 115..218 853..754 114 61 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1065..1093 683..655 109 86.2 Minus

LD05816.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:19:59 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10656241..10656898 407..1064 96 <- Minus
chrX 10656968..10657165 209..406 100 <- Minus
chrX 10659344..10659551 1..208 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:37:36 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 119..484 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:34 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 119..484 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:26 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 119..484 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:25 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 119..484 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:27:09 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 119..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:47:47 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 148..1211 1..1064 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:34 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 148..1211 1..1064 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:26 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 148..1211 1..1064 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:25 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 148..1211 1..1064 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:27:09 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 151..1214 1..1064 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:19:59 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
X 10767981..10768188 1..208 100   Minus
X 10764878..10765535 407..1064 99 <- Minus
X 10765605..10765802 209..406 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:19:59 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
X 10767981..10768188 1..208 100   Minus
X 10764878..10765535 407..1064 99 <- Minus
X 10765605..10765802 209..406 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:19:59 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
X 10767981..10768188 1..208 100   Minus
X 10764878..10765535 407..1064 99 <- Minus
X 10765605..10765802 209..406 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:26 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10658911..10659568 407..1064 99 <- Minus
arm_X 10659638..10659835 209..406 100 <- Minus
arm_X 10662014..10662221 1..208 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:05 Download gff for LD05816.complete
Subject Subject Range Query Range Percent Splice Strand
X 10772976..10773633 407..1064 99 <- Minus
X 10773703..10773900 209..406 100 <- Minus
X 10776079..10776286 1..208 100   Minus

LD05816.pep Sequence

Translation from 118 to 483

> LD05816.pep
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHE
EDYFLYIAYSDENVYGMAKIN*

LD05816.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20824-PA 121 GF20824-PA 1..121 1..121 631 99.2 Plus
Dana\GF23138-PA 122 GF23138-PA 3..118 1..116 527 84.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18902-PA 121 GG18902-PA 1..121 1..121 628 97.5 Plus
Dere\GG16757-PA 120 GG16757-PA 3..118 1..116 526 82.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12106-PA 119 GH12106-PA 1..119 1..119 617 99.2 Plus
Dgri\GH15861-PA 125 GH15861-PA 3..118 1..116 507 80.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-PA 121 CG32672-PA 1..121 1..121 638 100 Plus
Atg8b-PB 120 CG12334-PB 3..118 1..116 530 82.8 Plus
Atg8b-PA 120 CG12334-PA 3..118 1..116 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..107 21..121 482 92.1 Plus
Atg8a-PB 96 CG32672-PB 6..96 31..121 476 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15162-PA 119 GI15162-PA 1..119 1..119 618 99.2 Plus
Dmoj\GI23636-PA 122 GI23636-PA 3..122 1..120 514 79.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26902-PA 120 GL26902-PA 1..117 1..117 609 99.1 Plus
Dper\GL12240-PA 116 GL12240-PA 3..116 1..114 498 81.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22662-PA 120 GA22662-PA 1..117 1..117 609 99.1 Plus
Dpse\GA11562-PA 116 GA11562-PA 3..116 1..114 498 81.6 Plus
Dpse\GA23118-PA 116 GA23118-PA 3..116 1..114 498 81.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11288-PA 121 GM11288-PA 1..121 1..121 632 98.3 Plus
Dsec\GM15346-PA 266 GM15346-PA 149..264 1..116 539 82.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16015-PA 121 GD16015-PA 1..121 1..121 632 98.3 Plus
Dsim\GD20217-PA 227 GD20217-PA 110..225 1..116 538 82.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14868-PA 119 GJ14868-PA 1..119 1..119 617 99.2 Plus
Dvir\GJ24711-PA 124 GJ24711-PA 3..121 1..119 508 79.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16501-PA 119 GK16501-PA 1..118 1..118 614 99.2 Plus
Dwil\GK22506-PA 121 GK22506-PA 3..118 1..116 528 84.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15373-PA 121 GE15373-PA 1..121 1..121 632 98.3 Plus
Dyak\GE25252-PA 120 GE25252-PA 3..118 1..116 524 82.8 Plus

LD05816.hyp Sequence

Translation from 118 to 483

> LD05816.hyp
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHE
EDYFLYIAYSDENVYGMAKIN*

LD05816.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-PA 121 CG32672-PA 1..121 1..121 638 100 Plus
Atg8b-PB 120 CG12334-PB 3..118 1..116 530 82.8 Plus
Atg8b-PA 120 CG12334-PA 3..118 1..116 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..107 21..121 482 92.1 Plus
Atg8a-PB 96 CG32672-PB 6..96 31..121 476 100 Plus