Clone LD05893 Report

Search the DGRC for LD05893

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:58
Well:93
Vector:pBS SK-
Associated Gene/TranscriptCG15735-RA
Protein status:LD05893.pep: gold
Preliminary Size:1377
Sequenced Size:1221

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15735 2001-11-29 Blastp of sequenced clone
CG15735 2003-01-01 Sim4 clustering to Release 3
CG15735 2008-04-29 Release 5.5 accounting
CG15735 2008-08-15 Release 5.9 accounting
CG15735 2008-12-18 5.12 accounting

Clone Sequence Records

LD05893.complete Sequence

1221 bp (1221 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069351

> LD05893.complete
ACCAATAAATTTTTCGCGTACTTTTCCAACTTTTCAATTACCGAACCGCA
ATTGCCGCCAAAATAGATAGCCGATAGCTAGTCGAGCGAGTAACCAGCGA
GTTTTTGGCCAATTCACGCGACGATCAGGGGCAGTGGAAGCAGGAGCAGG
ATCTCGACCAGATCGCCAGGAAGCGACATTTCCATTAGAGCGGTTCAAGT
GAAAGCGAGTGAGCTGCACGGCACGAGAGAACGAGACAGACAGACGGCGA
GAGTGAGAGCGAGCGAGAGAGCTAGTTAAATCCTTTCGAGAATTCCAGGA
ATTCAAGCATCCAAAACAGCTGCTGCTGCCGCAAAATCATCAACATCATC
ACCATCGCTGTTTGTGAAACGTTGTTCAAGCAACGGCGTGCCAACAAACC
AGTATCGACATTTAGATCTAGATTCGAATCCCCTATCCACATAGCTTGTG
GGTGCACTTTTCCAGTTGGCCAATCTCAACCAGCAATTAAAAATGGCCGC
TGCCGCTGCGAGCGCAGTGAATGCAGTGAACGACTGCTTCAGCATCGGAT
CCACAGTCGTCTGTACGACCTGTTTCAACGAGGAGGTGGAGGGCGAGGTG
CTGGCCTTCGATCACAACACAAAGATGCTTATCCTGAAATGCCGATCCAA
GTCCACGGAGGAGCTGAGTGATATCTACGCGATGAACCTCTCGCTCTGCA
GCAACGTGCAGGTGATCAAGGAGTGCAACGGCAACTTTGATGATCCGCAA
AAGCTTAATCTGGAACAGGTCAAAATGCGTCTGAGGAAAACAGTTGAGCG
AAGACAGGACTACTTGAAGTCTAAGAATGCTGATGTCAGTCCAGAGGCGC
AGGAACTCTATAGAGCGATAGCCAAACAATACGGGTACAATGAAGTCTCC
TGGCAAGGACTTAACATACAGATCCTAAATGAAGTCACCATCTCGCCGCC
GTACCGAGTGGACAACGTGGTGTCCAGCTCGAACAACGAAACTTCATGCA
ACTACATCAAGCGCATCATCAAACAGTTCTTCAACACGAGGCCATCGCCC
GTCCCGGAAAGCGGAGCTGCGGCCAGCACCTCGTCACCATCGGTGTCTCC
CACGTCCTCATCTCTTGCATCTGGATCGCCGGTTCCCGCAAACTAATAAT
AAGCAGAAAAAAAACACAAACAAAACAAAACAAAAAAACAGAAATGTGCT
TCAAAAAAAAAAAAAAAAAAA

LD05893.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15735-RA 1443 CG15735-RA 119..1326 1..1208 6040 100 Plus
CG15735.a 874 CG15735.a 296..868 636..1208 2865 100 Plus
CG15735.a 874 CG15735.a 46..297 1..252 1260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11909754..11910390 1..637 3185 100 Plus
chrX 22417052 chrX 11911602..11911787 1018..1202 880 99.5 Plus
chrX 22417052 chrX 11910695..11910827 638..770 665 100 Plus
chrX 22417052 chrX 11911073..11911205 885..1017 665 100 Plus
chrX 22417052 chrX 11910888..11911008 765..885 605 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12018689..12019325 1..637 3185 100 Plus
X 23542271 X 12020535..12020725 1018..1208 955 100 Plus
X 23542271 X 12019628..12019760 638..770 665 100 Plus
X 23542271 X 12020006..12020138 885..1017 665 100 Plus
X 23542271 X 12019821..12019941 765..885 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12026787..12027423 1..637 3185 100 Plus
X 23527363 X 12028633..12028823 1018..1208 955 100 Plus
X 23527363 X 12028104..12028236 885..1017 665 100 Plus
X 23527363 X 12027726..12027858 638..770 665 100 Plus
X 23527363 X 12027919..12028039 765..885 605 100 Plus
Blast to na_te.dros performed 2019-03-16 21:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 529..620 306..397 117 61.3 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 4845..4904 1101..1041 113 67.2 Minus

LD05893.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:39:44 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11909754..11910390 1..637 100 -> Plus
chrX 11910695..11910825 638..768 100 -> Plus
chrX 11910892..11911008 769..885 100 -> Plus
chrX 11911074..11911205 886..1017 100 -> Plus
chrX 11911602..11911739 1018..1155 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:37:41 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 1..654 493..1146 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:16 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 1..654 493..1146 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:03:29 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 1..654 493..1146 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:51:03 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 1..654 493..1146 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:26:32 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 1..654 493..1146 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:59:45 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 46..1247 1..1202 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:16 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 46..1247 1..1202 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:03:29 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 50..1251 1..1202 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:51:03 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 46..1247 1..1202 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:26:32 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
CG15735-RA 50..1251 1..1202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:44 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
X 12018689..12019325 1..637 100 -> Plus
X 12019628..12019758 638..768 100 -> Plus
X 12019825..12019941 769..885 100 -> Plus
X 12020007..12020138 886..1017 100 -> Plus
X 12020535..12020719 1018..1202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:44 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
X 12018689..12019325 1..637 100 -> Plus
X 12019628..12019758 638..768 100 -> Plus
X 12019825..12019941 769..885 100 -> Plus
X 12020007..12020138 886..1017 100 -> Plus
X 12020535..12020719 1018..1202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:44 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
X 12018689..12019325 1..637 100 -> Plus
X 12019628..12019758 638..768 100 -> Plus
X 12019825..12019941 769..885 100 -> Plus
X 12020007..12020138 886..1017 100 -> Plus
X 12020535..12020719 1018..1202 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:03:29 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11913858..11913974 769..885 100 -> Plus
arm_X 11914040..11914171 886..1017 100 -> Plus
arm_X 11914568..11914752 1018..1202 100   Plus
arm_X 11912722..11913358 1..637 100 -> Plus
arm_X 11913661..11913791 638..768 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:27 Download gff for LD05893.complete
Subject Subject Range Query Range Percent Splice Strand
X 12026787..12027423 1..637 100 -> Plus
X 12027726..12027856 638..768 100 -> Plus
X 12027923..12028039 769..885 100 -> Plus
X 12028105..12028236 886..1017 100 -> Plus
X 12028633..12028817 1018..1202 100   Plus

LD05893.pep Sequence

Translation from 492 to 1145

> LD05893.pep
MAAAAASAVNAVNDCFSIGSTVVCTTCFNEEVEGEVLAFDHNTKMLILKC
RSKSTEELSDIYAMNLSLCSNVQVIKECNGNFDDPQKLNLEQVKMRLRKT
VERRQDYLKSKNADVSPEAQELYRAIAKQYGYNEVSWQGLNIQILNEVTI
SPPYRVDNVVSSSNNETSCNYIKRIIKQFFNTRPSPVPESGAAASTSSPS
VSPTSSSLASGSPVPAN*

LD05893.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19377-PA 228 GF19377-PA 1..191 1..189 965 95.3 Plus
Dana\GF23854-PA 187 GF23854-PA 7..186 15..183 293 37.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17703-PA 217 GG17703-PA 1..217 1..217 1140 99.1 Plus
Dere\GG13994-PA 186 GG13994-PA 7..181 15..179 277 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24166-PA 225 GH24166-PA 4..192 3..190 873 86.2 Plus
Dgri\GH15409-PA 205 GH15409-PA 8..183 16..179 283 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm12-PA 217 CG15735-PA 1..217 1..217 1108 100 Plus
Hez-PB 186 CG14164-PB 1..181 9..179 260 30.4 Plus
Hez-PA 186 CG14164-PA 1..181 9..179 260 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21767-PA 223 GI21767-PA 1..223 1..217 879 79.8 Plus
Dmoj\GI13014-PA 181 GI13014-PA 6..178 16..191 290 33.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20272-PA 214 GL20272-PA 1..186 1..185 903 94.1 Plus
Dper\GL14806-PA 197 GL14806-PA 5..193 1..179 261 32.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28636-PA 225 GA28636-PA 1..186 1..185 903 94.1 Plus
Dpse\GA25330-PA 200 GA25330-PA 22..196 15..179 261 34.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13250-PA 217 GM13250-PA 1..217 1..217 1142 99.5 Plus
Dsec\GM24830-PA 186 GM24830-PA 7..186 15..179 279 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17059-PA 217 GD17059-PA 1..217 1..217 1142 99.5 Plus
Dsim\GD12882-PA 186 GD12882-PA 7..181 15..179 287 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18539-PA 224 GJ18539-PA 1..192 1..191 900 87 Plus
Dvir\GJ12106-PA 191 GJ12106-PA 6..175 16..179 316 32.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10082-PA 239 GK10082-PA 18..205 12..198 831 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16490-PA 217 GE16490-PA 1..217 1..217 1141 99.1 Plus
Dyak\GE20290-PA 186 GE20290-PA 7..181 15..179 276 32.4 Plus

LD05893.hyp Sequence

Translation from 492 to 1145

> LD05893.hyp
MAAAAASAVNAVNDCFSIGSTVVCTTCFNEEVEGEVLAFDHNTKMLILKC
RSKSTEELSDIYAMNLSLCSNVQVIKECNGNFDDPQKLNLEQVKMRLRKT
VERRQDYLKSKNADVSPEAQELYRAIAKQYGYNEVSWQGLNIQILNEVTI
SPPYRVDNVVSSSNNETSCNYIKRIIKQFFNTRPSPVPESGAAASTSSPS
VSPTSSSLASGSPVPAN*

LD05893.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15735-PA 217 CG15735-PA 1..217 1..217 1108 100 Plus
CG14164-PB 186 CG14164-PB 1..181 9..179 260 30.4 Plus
CG14164-PA 186 CG14164-PA 1..181 9..179 260 30.4 Plus