Clone LD06293 Report

Search the DGRC for LD06293

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:62
Well:93
Vector:pBS SK-
Associated Gene/TranscriptManf-RA
Protein status:LD06293.pep: gold
Preliminary Size:1073
Sequenced Size:854

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7013 2001-01-01 Release 2 assignment
CG7013 2001-10-10 Blastp of sequenced clone
CG7013 2003-01-01 Sim4 clustering to Release 3
ARP-like 2008-04-29 Release 5.5 accounting
ARP-like 2008-08-15 Release 5.9 accounting
ARP-like 2008-12-18 5.12 accounting

Clone Sequence Records

LD06293.complete Sequence

854 bp (854 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061080

> LD06293.complete
AACGCTAACAATTCGGGGACAAAATCAAATCGCATGCAAAGAATTCAGTA
CAGTTAATTAAAGTACGCTCAAGCACAGTCGAAGTAATAACAAAATGAAG
ACGTGGTACATGGTGGTAGTGATCGGCTTCCTGGCGACGTTGGCCCAAAC
GTCGCTGGCCCTGAAAGAGGAGGACTGCGAAGTTTGCGTCAAGACGGTTA
GGCGGTTCGCAGATTCGCTGGACGACTCCACCAAGAAGGACTACAAACAG
ATCGAAACGGCCTTCAAAAAGTTCTGCAAAGCGCAGAAAAACAAGGAACA
CAGATTCTGTTACTACCTCGGCGGTCTGGAAGAATCCGCCACGGGCATCC
TCAACGAGCTGAGCAAACCCCTCAGTTGGTCCATGCCAGCTGAGAAGATC
TGCGAGAAGCTGAAGAAGAAGGACGCACAAATCTGCGACCTTCGCTATGA
GAAACAAATCGATCTGAACAGCGTGGACCTGAAGAAGCTGAAGGTACGCG
ACCTGAAGAAAATCCTCAACGACTGGGACGAGAGCTGTGACGGTTGCCTG
GAGAAGGGCGACTTCATCAAGCGTATCGAGGAGCTGAAGCCCAAGTACTC
GCGCAGCGAGCTGTAGAGCGCAGTCAGTTACTTGTGTAGTTACATGGAAC
ACGCCCACTTAGCTAAAACAACAACCACATGAAACGCCCCCTACACATCC
ATATTTTTAGTTAATTTACAATTTTGATAGACTTTGAGAGAATTGAATAT
AACTATATATGCCTAAAGATAAAACCTATATTTTGAAATAAAAAACAACA
AACACACAAGACCTCGTCCTCTCAAACGGTTGATAAAAAAAAAAAAAAAA
AAAA

LD06293.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Manf-RA 978 Manf-RA 142..978 1..837 4185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12175112..12175497 449..834 1930 100 Plus
chr3R 27901430 chr3R 12174113..12174294 1..182 895 99.5 Plus
chr3R 27901430 chr3R 12174582..12174723 308..449 710 100 Plus
chr3R 27901430 chr3R 12174369..12174495 181..307 635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16350416..16350804 449..837 1945 100 Plus
3R 32079331 3R 16349417..16349598 1..182 910 100 Plus
3R 32079331 3R 16349886..16350027 308..449 710 100 Plus
3R 32079331 3R 16349673..16349799 181..307 635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16091247..16091635 449..837 1945 100 Plus
3R 31820162 3R 16090248..16090429 1..182 910 100 Plus
3R 31820162 3R 16090717..16090858 308..449 710 100 Plus
3R 31820162 3R 16090504..16090630 181..307 635 100 Plus
Blast to na_te.dros performed 2019-03-16 10:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
NOF 4347 NOF FB 4347bp Derived from X51937 (g8297) (Rel. 44, Last updated, Version 6). 550..660 811..702 147 60.4 Minus
invader1 4032 invader1 INVADER 4032bp 3450..3536 712..798 138 62.1 Plus
TART-A 13424 TART-A 13424bp 1355..1418 234..302 108 66.7 Plus
TART-A 13424 TART-A 13424bp 12533..12596 234..302 108 66.7 Plus

LD06293.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:14:33 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12174113..12174294 1..182 99 -> Plus
chr3R 12174371..12174495 183..307 100 -> Plus
chr3R 12174582..12174723 308..449 100 -> Plus
chr3R 12175113..12175497 450..834 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:18 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
ARP-like-RA 1..522 95..616 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:25 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
Manf-RA 1..522 95..616 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:38:41 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
Manf-RA 1..522 95..616 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:40 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
ARP-like-RA 1..522 95..616 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:09 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
Manf-RA 1..522 95..616 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:20 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
ARP-like-RA 5..838 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:25 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
Manf-RA 52..885 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:41 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
Manf-RA 25..858 1..834 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:40 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
ARP-like-RA 5..838 1..834 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:09 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
Manf-RA 14..847 1..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:33 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16349417..16349598 1..182 100 -> Plus
3R 16349675..16349799 183..307 100 -> Plus
3R 16349886..16350027 308..449 100 -> Plus
3R 16350417..16350801 450..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:33 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16349417..16349598 1..182 100 -> Plus
3R 16349675..16349799 183..307 100 -> Plus
3R 16349886..16350027 308..449 100 -> Plus
3R 16350417..16350801 450..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:33 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16349417..16349598 1..182 100 -> Plus
3R 16349675..16349799 183..307 100 -> Plus
3R 16349886..16350027 308..449 100 -> Plus
3R 16350417..16350801 450..834 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:41 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12175139..12175320 1..182 100 -> Plus
arm_3R 12175397..12175521 183..307 100 -> Plus
arm_3R 12175608..12175749 308..449 100 -> Plus
arm_3R 12176139..12176523 450..834 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:28 Download gff for LD06293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16091248..16091632 450..834 100   Plus
3R 16090248..16090429 1..182 100 -> Plus
3R 16090506..16090630 183..307 100 -> Plus
3R 16090717..16090858 308..449 100 -> Plus

LD06293.pep Sequence

Translation from 94 to 615

> LD06293.pep
MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDY
KQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAE
KICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDG
CLEKGDFIKRIEELKPKYSRSEL*

LD06293.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18493-PA 173 GF18493-PA 1..173 1..173 803 88.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16999-PA 173 GG16999-PA 1..173 1..173 884 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23446-PA 173 GH23446-PA 1..173 1..173 751 82.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Manf-PA 173 CG7013-PA 1..173 1..173 909 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22948-PA 173 GI22948-PA 1..173 1..173 790 86.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21601-PA 173 GL21601-PA 1..173 1..173 805 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20031-PA 173 GA20031-PA 1..173 1..173 805 88.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15151-PA 173 GM15151-PA 1..173 1..173 883 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19093-PA 173 GD19093-PA 1..173 1..173 892 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23764-PA 173 GJ23764-PA 1..173 1..173 793 86.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13778-PA 173 GK13778-PA 1..173 1..173 780 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24392-PA 173 GE24392-PA 1..173 1..173 883 98.3 Plus

LD06293.hyp Sequence

Translation from 94 to 615

> LD06293.hyp
MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDY
KQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAE
KICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDG
CLEKGDFIKRIEELKPKYSRSEL*

LD06293.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Manf-PA 173 CG7013-PA 1..173 1..173 909 100 Plus