BDGP Sequence Production Resources |
Search the DGRC for LD06293
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 62 |
Well: | 93 |
Vector: | pBS SK- |
Associated Gene/Transcript | Manf-RA |
Protein status: | LD06293.pep: gold |
Preliminary Size: | 1073 |
Sequenced Size: | 854 |
Gene | Date | Evidence |
---|---|---|
CG7013 | 2001-01-01 | Release 2 assignment |
CG7013 | 2001-10-10 | Blastp of sequenced clone |
CG7013 | 2003-01-01 | Sim4 clustering to Release 3 |
ARP-like | 2008-04-29 | Release 5.5 accounting |
ARP-like | 2008-08-15 | Release 5.9 accounting |
ARP-like | 2008-12-18 | 5.12 accounting |
854 bp (854 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061080
> LD06293.complete AACGCTAACAATTCGGGGACAAAATCAAATCGCATGCAAAGAATTCAGTA CAGTTAATTAAAGTACGCTCAAGCACAGTCGAAGTAATAACAAAATGAAG ACGTGGTACATGGTGGTAGTGATCGGCTTCCTGGCGACGTTGGCCCAAAC GTCGCTGGCCCTGAAAGAGGAGGACTGCGAAGTTTGCGTCAAGACGGTTA GGCGGTTCGCAGATTCGCTGGACGACTCCACCAAGAAGGACTACAAACAG ATCGAAACGGCCTTCAAAAAGTTCTGCAAAGCGCAGAAAAACAAGGAACA CAGATTCTGTTACTACCTCGGCGGTCTGGAAGAATCCGCCACGGGCATCC TCAACGAGCTGAGCAAACCCCTCAGTTGGTCCATGCCAGCTGAGAAGATC TGCGAGAAGCTGAAGAAGAAGGACGCACAAATCTGCGACCTTCGCTATGA GAAACAAATCGATCTGAACAGCGTGGACCTGAAGAAGCTGAAGGTACGCG ACCTGAAGAAAATCCTCAACGACTGGGACGAGAGCTGTGACGGTTGCCTG GAGAAGGGCGACTTCATCAAGCGTATCGAGGAGCTGAAGCCCAAGTACTC GCGCAGCGAGCTGTAGAGCGCAGTCAGTTACTTGTGTAGTTACATGGAAC ACGCCCACTTAGCTAAAACAACAACCACATGAAACGCCCCCTACACATCC ATATTTTTAGTTAATTTACAATTTTGATAGACTTTGAGAGAATTGAATAT AACTATATATGCCTAAAGATAAAACCTATATTTTGAAATAAAAAACAACA AACACACAAGACCTCGTCCTCTCAAACGGTTGATAAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Manf-RA | 978 | Manf-RA | 142..978 | 1..837 | 4185 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 12175112..12175497 | 449..834 | 1930 | 100 | Plus |
chr3R | 27901430 | chr3R | 12174113..12174294 | 1..182 | 895 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 12174582..12174723 | 308..449 | 710 | 100 | Plus |
chr3R | 27901430 | chr3R | 12174369..12174495 | 181..307 | 635 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 16350416..16350804 | 449..837 | 1945 | 100 | Plus |
3R | 32079331 | 3R | 16349417..16349598 | 1..182 | 910 | 100 | Plus |
3R | 32079331 | 3R | 16349886..16350027 | 308..449 | 710 | 100 | Plus |
3R | 32079331 | 3R | 16349673..16349799 | 181..307 | 635 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 16091247..16091635 | 449..837 | 1945 | 100 | Plus |
3R | 31820162 | 3R | 16090248..16090429 | 1..182 | 910 | 100 | Plus |
3R | 31820162 | 3R | 16090717..16090858 | 308..449 | 710 | 100 | Plus |
3R | 31820162 | 3R | 16090504..16090630 | 181..307 | 635 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
NOF | 4347 | NOF FB 4347bp Derived from X51937 (g8297) (Rel. 44, Last updated, Version 6). | 550..660 | 811..702 | 147 | 60.4 | Minus |
invader1 | 4032 | invader1 INVADER 4032bp | 3450..3536 | 712..798 | 138 | 62.1 | Plus |
TART-A | 13424 | TART-A 13424bp | 1355..1418 | 234..302 | 108 | 66.7 | Plus |
TART-A | 13424 | TART-A 13424bp | 12533..12596 | 234..302 | 108 | 66.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12174113..12174294 | 1..182 | 99 | -> | Plus |
chr3R | 12174371..12174495 | 183..307 | 100 | -> | Plus |
chr3R | 12174582..12174723 | 308..449 | 100 | -> | Plus |
chr3R | 12175113..12175497 | 450..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ARP-like-RA | 1..522 | 95..616 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Manf-RA | 1..522 | 95..616 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Manf-RA | 1..522 | 95..616 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ARP-like-RA | 1..522 | 95..616 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Manf-RA | 1..522 | 95..616 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ARP-like-RA | 5..838 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Manf-RA | 52..885 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Manf-RA | 25..858 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ARP-like-RA | 5..838 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Manf-RA | 14..847 | 1..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16349417..16349598 | 1..182 | 100 | -> | Plus |
3R | 16349675..16349799 | 183..307 | 100 | -> | Plus |
3R | 16349886..16350027 | 308..449 | 100 | -> | Plus |
3R | 16350417..16350801 | 450..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16349417..16349598 | 1..182 | 100 | -> | Plus |
3R | 16349675..16349799 | 183..307 | 100 | -> | Plus |
3R | 16349886..16350027 | 308..449 | 100 | -> | Plus |
3R | 16350417..16350801 | 450..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16349417..16349598 | 1..182 | 100 | -> | Plus |
3R | 16349675..16349799 | 183..307 | 100 | -> | Plus |
3R | 16349886..16350027 | 308..449 | 100 | -> | Plus |
3R | 16350417..16350801 | 450..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12175139..12175320 | 1..182 | 100 | -> | Plus |
arm_3R | 12175397..12175521 | 183..307 | 100 | -> | Plus |
arm_3R | 12175608..12175749 | 308..449 | 100 | -> | Plus |
arm_3R | 12176139..12176523 | 450..834 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16091248..16091632 | 450..834 | 100 | Plus | |
3R | 16090248..16090429 | 1..182 | 100 | -> | Plus |
3R | 16090506..16090630 | 183..307 | 100 | -> | Plus |
3R | 16090717..16090858 | 308..449 | 100 | -> | Plus |
Translation from 94 to 615
> LD06293.pep MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDY KQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAE KICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDG CLEKGDFIKRIEELKPKYSRSEL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18493-PA | 173 | GF18493-PA | 1..173 | 1..173 | 803 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16999-PA | 173 | GG16999-PA | 1..173 | 1..173 | 884 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23446-PA | 173 | GH23446-PA | 1..173 | 1..173 | 751 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Manf-PA | 173 | CG7013-PA | 1..173 | 1..173 | 909 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22948-PA | 173 | GI22948-PA | 1..173 | 1..173 | 790 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21601-PA | 173 | GL21601-PA | 1..173 | 1..173 | 805 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20031-PA | 173 | GA20031-PA | 1..173 | 1..173 | 805 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15151-PA | 173 | GM15151-PA | 1..173 | 1..173 | 883 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19093-PA | 173 | GD19093-PA | 1..173 | 1..173 | 892 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23764-PA | 173 | GJ23764-PA | 1..173 | 1..173 | 793 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13778-PA | 173 | GK13778-PA | 1..173 | 1..173 | 780 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24392-PA | 173 | GE24392-PA | 1..173 | 1..173 | 883 | 98.3 | Plus |
Translation from 94 to 615
> LD06293.hyp MKTWYMVVVIGFLATLAQTSLALKEEDCEVCVKTVRRFADSLDDSTKKDY KQIETAFKKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAE KICEKLKKKDAQICDLRYEKQIDLNSVDLKKLKVRDLKKILNDWDESCDG CLEKGDFIKRIEELKPKYSRSEL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Manf-PA | 173 | CG7013-PA | 1..173 | 1..173 | 909 | 100 | Plus |