Clone LD06392 Report

Search the DGRC for LD06392

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:63
Well:92
Vector:pBS SK-
Associated Gene/Transcriptr2d2-RA
Protein status:LD06392.pep: gold
Preliminary Size:1312
Sequenced Size:1132

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7138 2003-01-01 Sim4 clustering to Release 3
CG7138 2004-04-27 Blastp of sequenced clone
r2d2 2008-04-29 Release 5.5 accounting
r2d2 2008-08-15 Release 5.9 accounting
r2d2 2008-12-18 5.12 accounting

Clone Sequence Records

LD06392.complete Sequence

1132 bp (1132 high quality bases) assembled on 2004-04-27

GenBank Submission: BT014919

> LD06392.complete
ATTCGCGTGCCATCTCTAATAACATTGCAGTGCTTTAGATATTTTATAAA
TTATATATATGGTTATATTCTGTTGAATGTTAGCACGTCCGACGTGCCTT
TTCCCCTTGAACTCATGGATAACAAGTCAGCCGTATCTGCTCTACAGGAG
TTTTGTGCCCGGACACAGATTAATCTACCAACATACAGTTTTATTCCCGG
CGAAGACGGAGGGTACGTCTGTAAAGTTGAACTATTGGAGATAGAGGCCC
TTGGAAATGGGCGTTCGAAGCGTGATGCCAAACACCTGGCTGCCAGCAAT
ATCTTGCGTAAAATCCAACTGCTGCCCGGCATACACGGCTTGATGAAGGA
TTCGACTGTGGGTGATCTGGATGAGGAACTGACTAACCTCAACCGGGACA
TGGTGAAGGAGCTGCGTGACTACTGCGTCCGCCGCGAGATGCCACTGCCC
TGCATTGAGGTAGTGCAGCAAAGCGGCACCCCGAGCGCCCCGGAATTCGT
GGCCTGTTGCTCCGTGGCCTCCATAGTACGCTACGGAAAGTCGGACAAAA
AGAAGGATGCCCGTCAGCGAGCGGCCATTGAAATGCTGGCCTTAATCTCC
AGCAATTCGGACAATTTGCGTCCGGATCAAATGCAAGTAGCGAGCACAAG
CAAATTGAAAGTTGTTGATATGGAAGAATCTATGGAGGAATTGGAGGCAT
TGCGCAGAAAGAAATTTACCACCTACTGGGAGTTGAAGGAAGCCGGGAGC
GTAGACCATACAGGCATGCGGCTCTGCGACCGACACAACTACTTCAAGAA
CTTCTATCCTACCCTGAAAAAGGAGGCCATTGAGGCCATCAATTCAGATG
AATACGAGAGCTCCAAGGATAAGGCTATGGACGTAATGAGCTCTTTAAAG
ATAACACCCAAAATCAGTGAAGTGGAATCTTCATCGTTGGTTCCCTTGCT
TAGCGTCGAGCTTAATTGTGCATTCGACGTGGTCCTTATGGCAAAGGAGA
CCGATATCTACGACCATATAATAGACTATTTTCGCACCATGTTGATTTAA
TGCGTATAACATTTATTCAACTATTCTAGCTTAAAACTAAGTAAACTCGT
TTTATTTACACTCTAAAAAAAAAAAAAAAAAA

LD06392.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
r2d2-RB 1906 r2d2-RB 237..1351 1..1115 5575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7799798..7800653 259..1114 4280 100 Plus
chr2L 23010047 chr2L 7799467..7799726 1..260 1300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7800720..7801576 259..1115 4285 100 Plus
2L 23513712 2L 7800389..7800648 1..260 1300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7800720..7801576 259..1115 4285 100 Plus
2L 23513712 2L 7800389..7800648 1..260 1300 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:45:05 has no hits.

LD06392.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:46:16 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7799467..7799725 1..259 91 -> Plus
chr2L 7799799..7800653 260..1114 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:23 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 1..936 115..1050 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:37 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RB 1..936 115..1050 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:59 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 1..936 115..1050 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:27 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 1..936 115..1050 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:47:19 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 1..936 115..1050 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:53 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 108..1221 1..1114 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:37 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 108..1221 1..1114 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:59 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 150..1263 1..1114 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:27 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 108..1221 1..1114 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:47:19 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
r2d2-RA 150..1263 1..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:16 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7800389..7800647 1..259 100 -> Plus
2L 7800721..7801575 260..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:16 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7800389..7800647 1..259 100 -> Plus
2L 7800721..7801575 260..1114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:16 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7800389..7800647 1..259 100 -> Plus
2L 7800721..7801575 260..1114 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:59 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7800389..7800647 1..259 100 -> Plus
arm_2L 7800721..7801575 260..1114 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:45 Download gff for LD06392.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7800389..7800647 1..259 100 -> Plus
2L 7800721..7801575 260..1114 100   Plus

LD06392.hyp Sequence

Translation from 0 to 1049

> LD06392.hyp
IRVPSLITLQCFRYFINYIYGYILLNVSTSDVPFPLELMDNKSAVSALQE
FCARTQINLPTYSFIPGEDGGYVCKVELLEIEALGNGRSKRDAKHLAASN
ILRKIQLLPGIHGLMKDSTVGDLDEELTNLNRDMVKELRDYCVRREMPLP
CIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALIS
SNSDNLRPDQMQVASTSKLKVVDMEESMEELEALRRKKFTTYWELKEAGS
VDHTGMRLCDRHNYFKNFYPTLKKEAIEAINSDEYESSKDKAMDVMSSLK
ITPKISEVESSSLVPLLSVELNCAFDVVLMAKETDIYDHIIDYFRTMLI*

LD06392.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
r2d2-PC 311 CG7138-PC 1..311 39..349 1584 100 Plus
r2d2-PB 311 CG7138-PB 1..311 39..349 1584 100 Plus
r2d2-PA 311 CG7138-PA 1..311 39..349 1584 100 Plus

LD06392.pep Sequence

Translation from 114 to 1049

> LD06392.pep
MDNKSAVSALQEFCARTQINLPTYSFIPGEDGGYVCKVELLEIEALGNGR
SKRDAKHLAASNILRKIQLLPGIHGLMKDSTVGDLDEELTNLNRDMVKEL
RDYCVRREMPLPCIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDAR
QRAAIEMLALISSNSDNLRPDQMQVASTSKLKVVDMEESMEELEALRRKK
FTTYWELKEAGSVDHTGMRLCDRHNYFKNFYPTLKKEAIEAINSDEYESS
KDKAMDVMSSLKITPKISEVESSSLVPLLSVELNCAFDVVLMAKETDIYD
HIIDYFRTMLI*

LD06392.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21798-PA 316 GF21798-PA 1..316 1..311 1090 65.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10497-PA 322 GG10497-PA 8..322 1..311 1207 71.7 Plus
Dere\GG23502-PA 118 GG23502-PA 7..118 200..311 290 48.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10357-PA 317 GH10357-PA 1..317 1..311 932 56.1 Plus
Dgri\GH10358-PA 206 GH10358-PA 86..206 186..311 272 42.2 Plus
Dgri\GH12989-PA 70 GH12989-PA 1..70 242..311 175 45.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
r2d2-PC 311 CG7138-PC 1..311 1..311 1584 100 Plus
r2d2-PB 311 CG7138-PB 1..311 1..311 1584 100 Plus
r2d2-PA 311 CG7138-PA 1..311 1..311 1584 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21342-PA 318 GI21342-PA 1..318 1..311 956 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19287-PA 314 GL19287-PA 1..313 1..310 921 55.6 Plus
Dper\GL19450-PA 398 GL19450-PA 275..397 183..310 204 34.4 Plus
Dper\GL19450-PA 398 GL19450-PA 1..111 1..105 171 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20129-PA 314 GA20129-PA 1..313 1..310 920 55.6 Plus
Dpse\GA25965-PA 398 GA25965-PA 275..397 183..310 201 32.8 Plus
Dpse\GA25965-PA 398 GA25965-PA 1..111 1..105 176 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\r2d2-PA 311 GM16576-PA 1..311 1..311 1378 81 Plus
Dsec\GM13295-PA 133 GM13295-PA 1..132 175..310 294 47.8 Plus
Dsec\GM23047-PA 619 GM23047-PA 1..75 1..69 197 54.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\r2d2-PA 311 GD23489-PA 1..311 1..311 1369 80.7 Plus
Dsim\GD22464-PA 133 GD22464-PA 2..132 177..310 277 48.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11132-PA 318 GJ11132-PA 1..318 1..311 971 56.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14818-PA 303 GK14818-PA 1..303 1..311 939 57.5 Plus
Dwil\GK18621-PA 297 GK18621-PA 1..294 1..299 549 41.9 Plus
Dwil\GK18578-PA 248 GK18578-PA 8..247 66..310 463 41.8 Plus
Dwil\GK18553-PA 248 GK18553-PA 8..247 66..310 460 41.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\r2d2-PA 321 GE14626-PA 8..321 1..311 1214 74.5 Plus
Dyak\GE18330-PA 129 GE18330-PA 24..129 206..311 296 51.9 Plus