Clone LD06393 Report

Search the DGRC for LD06393

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:63
Well:93
Vector:pBS SK-
Associated Gene/TranscriptCG6084-RA
Protein status:LD06393.pep: gold
Preliminary Size:1337
Sequenced Size:1123

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6084 2001-01-01 Release 2 assignment
CG6084 2002-12-11 Blastp of sequenced clone
CG6084 2003-01-01 Sim4 clustering to Release 3
CG6084 2008-04-29 Release 5.5 accounting
CG6084 2008-08-15 Release 5.9 accounting
CG6084 2008-12-18 5.12 accounting

Clone Sequence Records

LD06393.complete Sequence

1123 bp (1123 high quality bases) assembled on 2002-12-11

GenBank Submission: BT003280

> LD06393.complete
TTAAAAGATTCCCAATTGTATTATAAATATTTATAAATATCCTTAAACAA
TAAGCGAAAATATAGTACAATGGCTGTACCGAACGTTAAATTCAACAACG
GCAAGGAAGTCCCAATCATTGGACTGGGAACCTGGGGCAGCCCCAAGGGT
CAGGTCACCGAGGCTGTCAAAGTTGCCATTGATGCCGGATACAGGCACAT
TGACTGTGCCTATGTATACCAAAACGAGGATGAGGTCGGAGATGGTGTTG
AGGCCAAGATCAAGGAGGGCGTTGTCAAGCGTGAGGATCTGTTCATCACC
AGCAAACTGTGGAACACTTTCCATCGCCCGGATCTTGTCAAGTCGGCATT
GGAGAACACATTGAGCTCCCTGAAGCTGAAGTACCTCGATCTGTACCTTA
TCCACTGGCCCATGGGCTACAAGGAGGGATGCGATCTGTTCCCCACCGAC
AAGGATGGCAAGACGCTGTACTCGCCGGTTGATTACGTCGACACGTGGAA
GGCCATGGAGAAGTTGGTGGAAGAGGGTCTGGTCAAGTCCATTGGTGTTT
CCAACTTCAACAGAAGGCAGATCGAGCGCGTGCTTGAGGTGGCCACTATT
CCACCAGTAACCAATCAGATTGAGTGCCATCCATATCTGACCCAGAAGAA
GCTGATTGACTTCTGCAAGTCAAAGGACATTACAATCACTGCCTACAGTC
CCTTGGGATCTCCCAACCGCCCATGGGCCAAGGCTGGTGATCCGGTCATC
CTAGAGGAGGCTAAGATCAAGGAAATTGCCGCTAAGAAGAAGAAGACCCC
TGGACAGATCCTTATTCGATACCAGGTTCAGCGTGCCAACATTGTTATCC
CCAAATCTGTGACCAAGGACCGCATCGAGTCCAACTTCCAGGTCTTCGAC
TTCGAACTGACACCTGAGGAAATCGAAATCATCGAAAGCTTCGAGTGCAA
CGGCCGCCTTGTTCCCCTACTCAACCAATACGGTCACCCTCACCACCCTT
TCGAGAAGGACGAATACTAGAAAGCGACACAGTGCTCGGTTCAAATCTAT
AATTTGTTGCATAATCATTTTATCTTTAATCGTACGAATAAACAAAAATA
CAAATAAAAAAAAAAAAAAAAAA

LD06393.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6084-RA 1273 CG6084-RA 51..1157 1..1107 5535 100 Plus
CG6084.b 1454 CG6084.b 51..1024 1..974 4870 100 Plus
CG6084.a 1232 CG6084.a 248..1216 139..1107 4845 100 Plus
CG6084.b 1454 CG6084.b 1206..1338 975..1107 665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11612400..11612884 765..281 2395 99.6 Minus
chr3L 24539361 chr3L 11612131..11612341 974..764 1040 99.5 Minus
chr3L 24539361 chr3L 11612950..11613092 281..139 700 99.3 Minus
chr3L 24539361 chr3L 11614454..11614591 138..1 690 100 Minus
chr3L 24539361 chr3L 11611448..11611578 1105..975 625 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11621483..11621967 765..281 2425 100 Minus
3L 28110227 3L 11621214..11621424 974..764 1055 100 Minus
3L 28110227 3L 11622033..11622175 281..139 715 100 Minus
3L 28110227 3L 11623548..11623685 138..1 690 100 Minus
3L 28110227 3L 11620533..11620665 1107..975 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11614583..11615067 765..281 2425 100 Minus
3L 28103327 3L 11614314..11614524 974..764 1055 100 Minus
3L 28103327 3L 11615133..11615275 281..139 715 100 Minus
3L 28103327 3L 11616648..11616785 138..1 690 100 Minus
3L 28103327 3L 11613633..11613765 1107..975 665 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:19:10 has no hits.

LD06393.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:20:14 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11611448..11611578 975..1105 98 <- Minus
chr3L 11612131..11612339 766..974 99 <- Minus
chr3L 11612400..11612883 282..765 99 <- Minus
chr3L 11612950..11613092 139..281 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:26 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..951 70..1020 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:59:53 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..951 70..1020 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:40 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..951 70..1020 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:29 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..951 70..1020 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:27:39 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..951 70..1020 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:16:57 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:59:53 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:40 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 31..1135 1..1105 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:29 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 1..1105 1..1105 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:27:39 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
CG6084-RA 31..1135 1..1105 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:20:14 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11620535..11620665 975..1105 100 <- Minus
3L 11621214..11621422 766..974 100 <- Minus
3L 11621483..11621966 282..765 100 <- Minus
3L 11622033..11622175 139..281 100 <- Minus
3L 11623548..11623685 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:20:14 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11620535..11620665 975..1105 100 <- Minus
3L 11621214..11621422 766..974 100 <- Minus
3L 11621483..11621966 282..765 100 <- Minus
3L 11622033..11622175 139..281 100 <- Minus
3L 11623548..11623685 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:20:14 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11620535..11620665 975..1105 100 <- Minus
3L 11621214..11621422 766..974 100 <- Minus
3L 11621483..11621966 282..765 100 <- Minus
3L 11622033..11622175 139..281 100 <- Minus
3L 11623548..11623685 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:40 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11614314..11614522 766..974 100 <- Minus
arm_3L 11613635..11613765 975..1105 100 <- Minus
arm_3L 11614583..11615066 282..765 100 <- Minus
arm_3L 11615133..11615275 139..281 100 <- Minus
arm_3L 11616648..11616785 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:13 Download gff for LD06393.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11614314..11614522 766..974 100 <- Minus
3L 11614583..11615066 282..765 100 <- Minus
3L 11615133..11615275 139..281 100 <- Minus
3L 11616648..11616785 1..138 100   Minus
3L 11613635..11613765 975..1105 100 <- Minus

LD06393.pep Sequence

Translation from 69 to 1019

> LD06393.pep
MAVPNVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVY
QNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSS
LKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKAMEKLV
EEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFCK
SKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIR
YQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPL
LNQYGHPHHPFEKDEY*

LD06393.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24531-PA 350 GF24531-PA 38..350 4..316 1340 83.1 Plus
Dana\GF24530-PA 313 GF24530-PA 1..301 14..312 897 54.5 Plus
Dana\GF10249-PA 317 GF10249-PA 6..313 3..311 789 49.8 Plus
Dana\GF10250-PA 320 GF10250-PA 6..313 3..311 744 47.3 Plus
Dana\GF13790-PA 311 GF13790-PA 5..311 3..316 717 45.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13904-PA 373 GG13904-PA 58..373 1..316 1536 96.2 Plus
Dere\GG13903-PA 320 GG13903-PA 1..315 1..312 917 53.7 Plus
Dere\GG14235-PA 316 GG14235-PA 5..312 3..311 788 49.2 Plus
Dere\GG14236-PA 320 GG14236-PA 10..313 7..311 741 49.2 Plus
Dere\GG10801-PA 311 GG10801-PA 5..311 3..316 717 44.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16631-PA 318 GH16631-PA 4..317 2..314 1300 80.3 Plus
Dgri\GH16629-PA 321 GH16629-PA 1..315 1..314 946 53.3 Plus
Dgri\GH15710-PA 317 GH15710-PA 6..314 3..312 793 49 Plus
Dgri\GH20139-PA 311 GH20139-PA 5..311 3..316 702 44.3 Plus
Dgri\GH16848-PA 385 GH16848-PA 35..346 1..314 676 39.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6084-PA 316 CG6084-PA 1..316 1..316 1673 100 Plus
CG6084-PC 350 CG6084-PC 38..350 4..316 1602 96.8 Plus
CG6084-PD 316 CG6084-PD 1..316 1..316 1599 97.2 Plus
CG6084-PB 350 CG6084-PB 38..350 4..316 1528 93.9 Plus
CG6083-PA 322 CG6083-PA 1..315 1..312 890 53.3 Plus
CG10863-PA 316 CG10863-PA 5..312 3..311 773 49.2 Plus
CG10638-PD 317 CG10638-PD 5..313 4..311 769 51 Plus
CG10638-PA 317 CG10638-PA 5..313 4..311 769 51 Plus
CG12766-PA 320 CG12766-PA 10..313 7..311 720 48.5 Plus
CG9436-PA 311 CG9436-PA 6..311 4..316 688 44.8 Plus
CG10638-PB 310 CG10638-PB 5..310 4..311 642 42.9 Plus
ARY-PD 384 CG40064-PD 36..345 1..312 642 39.6 Plus
CG2767-PA 329 CG2767-PA 9..319 8..310 622 42.8 Plus
ARY-PC 366 CG40064-PC 45..327 28..312 595 40.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11589-PA 318 GI11589-PA 5..318 3..316 1315 82.2 Plus
Dmoj\GI11588-PA 328 GI11588-PA 1..317 1..315 932 53.3 Plus
Dmoj\GI13068-PA 317 GI13068-PA 5..313 4..311 805 51.3 Plus
Dmoj\GI12765-PA 317 GI12765-PA 9..314 6..312 774 49.2 Plus
Dmoj\GI20232-PA 311 GI20232-PA 5..307 3..311 714 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22808-PA 318 GL22808-PA 5..318 3..316 1482 89.5 Plus
Dper\GL22807-PA 355 GL22807-PA 1..343 1..312 786 46.1 Plus
Dper\GL16200-PA 317 GL16200-PA 6..313 3..311 769 47.9 Plus
Dper\GL10976-PA 311 GL10976-PA 5..311 3..316 739 45.6 Plus
Dper\GL24949-PA 440 GL24949-PA 148..436 24..311 730 51 Plus
Dper\GL24949-PA 440 GL24949-PA 5..132 4..129 299 44.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19342-PA 318 GA19342-PA 5..318 3..316 1485 89.8 Plus
Dpse\GA19341-PA 326 GA19341-PA 1..314 1..312 913 52.2 Plus
Dpse\GA10606-PA 317 GA10606-PA 6..313 3..311 771 47.9 Plus
Dpse\GA21786-PA 311 GA21786-PA 5..311 3..316 739 45.6 Plus
Dpse\GA23569-PA 317 GA23569-PA 25..313 24..311 732 51.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24729-PA 373 GM24729-PA 58..373 1..316 1421 95.6 Plus
Dsec\GM24728-PA 320 GM24728-PA 1..315 1..312 911 53.7 Plus
Dsec\GM14027-PA 316 GM14027-PA 5..312 3..311 785 48.6 Plus
Dsec\GM14028-PA 320 GM14028-PA 10..313 7..311 732 48.9 Plus
Dsec\GM24650-PA 544 GM24650-PA 260..540 32..311 708 51.1 Plus
Dsec\GM24650-PA 544 GM24650-PA 5..250 4..251 568 46.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12789-PA 350 GD12789-PA 38..350 4..316 1361 93.6 Plus
Dsim\GD12788-PA 320 GD12788-PA 1..315 1..312 913 53.7 Plus
Dsim\GD13308-PA 316 GD13308-PA 5..312 3..311 788 48.9 Plus
Dsim\GD13309-PA 320 GD13309-PA 10..313 7..311 737 48.9 Plus
Dsim\GD10303-PA 311 GD10303-PA 5..311 3..316 721 45.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11267-PA 352 GJ11267-PA 38..352 2..316 1299 81.6 Plus
Dvir\GJ11266-PA 321 GJ11266-PA 1..316 1..314 944 54.1 Plus
Dvir\GJ16106-PA 318 GJ16106-PA 10..315 6..312 773 49.5 Plus
Dvir\GJ13816-PA 317 GJ13816-PA 4..313 3..311 770 49.8 Plus
Dvir\GJ20182-PA 311 GJ20182-PA 5..307 3..311 712 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14636-PA 318 GK14636-PA 5..318 3..316 1456 86.6 Plus
Dwil\GK17015-PA 318 GK17015-PA 5..318 3..316 1377 85.1 Plus
Dwil\GK17013-PA 323 GK17013-PA 1..314 1..312 908 54.8 Plus
Dwil\GK16694-PA 314 GK16694-PA 1..311 1..312 786 48.7 Plus
Dwil\GK22153-PA 311 GK22153-PA 5..311 3..316 753 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20195-PA 350 GE20195-PA 38..350 4..316 1365 93.6 Plus
Dyak\GE20194-PA 320 GE20194-PA 1..315 1..312 914 54 Plus
Dyak\GE20663-PA 316 GE20663-PA 5..312 3..311 794 49.5 Plus
Dyak\GE20664-PA 320 GE20664-PA 10..313 7..311 742 48.9 Plus
Dyak\GE24510-PA 311 GE24510-PA 5..311 3..316 721 44.6 Plus

LD06393.hyp Sequence

Translation from 69 to 1019

> LD06393.hyp
MAVPNVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVY
QNEDEVGDGVEAKIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSS
LKLKYLDLYLIHWPMGYKEGCDLFPTDKDGKTLYSPVDYVDTWKAMEKLV
EEGLVKSIGVSNFNRRQIERVLEVATIPPVTNQIECHPYLTQKKLIDFCK
SKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKKKTPGQILIR
YQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPL
LNQYGHPHHPFEKDEY*

LD06393.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6084-PA 316 CG6084-PA 1..316 1..316 1673 100 Plus
CG6084-PC 350 CG6084-PC 38..350 4..316 1602 96.8 Plus
CG6084-PD 316 CG6084-PD 1..316 1..316 1599 97.2 Plus
CG6084-PB 350 CG6084-PB 38..350 4..316 1528 93.9 Plus
CG6083-PA 322 CG6083-PA 1..315 1..312 890 53.3 Plus