Clone LD06441 Report

Search the DGRC for LD06441

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:64
Well:41
Vector:pBS SK-
Associated Gene/TranscriptmRpS35-RA
Protein status:LD06441.pep: gold
Preliminary Size:1336
Sequenced Size:1165

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2101 2002-01-01 Sim4 clustering to Release 2
CG2101 2003-01-01 Sim4 clustering to Release 3
CG2101 2004-08-13 Blastp of sequenced clone
mRpS35 2008-04-29 Release 5.5 accounting
mRpS35 2008-08-15 Release 5.9 accounting
mRpS35 2008-12-18 5.12 accounting

Clone Sequence Records

LD06441.complete Sequence

1165 bp (1165 high quality bases) assembled on 2004-08-13

GenBank Submission: BT016117

> LD06441.complete
TTCGTTGGCGCATGGTTTACGTAAAAGCCGCATAAATCGCTGGAAATATT
AGTTAAAATTAGGTATCTAAGCTTAAAATTAAACATAAAACCATGTCCAG
TGCGCTGACTCGCCTGTTGGAGCGCCTGCCACTGAAAAAACAGACGGCGC
AAAGCGGTATTCGTGTTTTTTCCAACCAGGAGCAGCGGCAAGAAATTGAG
GATGATGAAGAATTCCGAGTGCTCAGCCTGCGGACGGTGAAGCAGCAGAT
GCAGAAGCGCCAGCAGGTCCGTCGGGATCCCATCACACCGCCGCGCACTG
GCCGCATGGCGGTGGATCAGGACTGGACGGCCGTTTGGCCAGGACCACGT
TCGTTCCACCCGGCCAGTGTGCCTCTGCCACTGCGGCAGGGATTCACGGA
ACGCGGAGCAGCAGCTCCGTCGAAGTTCGCCAATGCAGAGCTGATGAAGA
TACCCAACTTTCTGCACTTGACACCGCCGGCCATCCGTCAGCAATGCGAA
GCCATCAAGAAGTTCTGCACGCCATGGCCAAAGGGTCTGGAGACAGAGGC
CAAGTGGCAGCGCCACTTCCCCCTGGAGGTCACCACCACAGACTACTGCC
AGAGTTTGCCCACGATCAGGAATCCGGAGGCCAGGCGCGTCACCATTACC
CTGAAGCTCTCTGACCTGAAGTTCGATGCGCACGCCAGGGATAAGTTCCT
GCGCCTGGTGGGCGATCGCTACAACAAGGACACGGACCTCGTTACCTTCG
TCACGGATCGCTGTCCGCAGAAGAAGCAGAACTACGACTACGCCCTGTAT
CTGCTCACCGCTTGCTATCACGAATCCTTTGTCACCGAGCCGTGGGAGGC
CACCAAATCGGAGGCCGACATGGAGGTCTATCTGTTCGAGCGTAACCAGT
CGAAGGTCTCCGCCGAGGGAATCCTCAACTGGAACGCCAAGAAGGGTGCT
CCAAAAGTGGTTCCCAGCAAGTCATTCGCTGAATGCGTGGAGAAACTGAT
AAACGAAGGCGAAAACGAGTACAACTTGGGCAAATACAAGGAGGAGGTCA
AGAAGATGTTGAACATTGCCTAGGAAACTGGATAGTTGAGTGAACCAATA
AAGCGAGAAGTTGTTAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

LD06441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS35-RA 1291 mRpS35-RA 91..1214 1..1124 5620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2780629..2781542 209..1122 4525 99.7 Plus
chr3L 24539361 chr3L 2780358..2780567 1..210 1050 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:52:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2781192..2782107 209..1124 4580 100 Plus
3L 28110227 3L 2780921..2781130 1..210 1050 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2781192..2782107 209..1124 4580 100 Plus
3L 28103327 3L 2780921..2781130 1..210 1050 100 Plus
Blast to na_te.dros performed 2019-03-15 13:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Doc2-element 4789 Doc2-element DOC2 4789bp 1211..1314 45..142 110 59.6 Plus

LD06441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:20:19 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2780358..2780567 1..210 100 -> Plus
chr3L 2780631..2781542 211..1122 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:30 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..981 93..1073 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:33:07 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..981 93..1073 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:51 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..981 93..1073 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:17:02 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..981 93..1073 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:27:49 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..981 93..1073 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:38:49 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..1122 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:33:07 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..1122 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:51 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 23..1144 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:17:03 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 1..1122 1..1122 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:27:49 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS35-RA 23..1144 1..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:20:19 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2780921..2781130 1..210 100 -> Plus
3L 2781194..2782105 211..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:20:19 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2780921..2781130 1..210 100 -> Plus
3L 2781194..2782105 211..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:20:19 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2780921..2781130 1..210 100 -> Plus
3L 2781194..2782105 211..1122 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:51 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2780921..2781130 1..210 100 -> Plus
arm_3L 2781194..2782105 211..1122 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:54:00 Download gff for LD06441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2780921..2781130 1..210 100 -> Plus
3L 2781194..2782105 211..1122 100   Plus

LD06441.hyp Sequence

Translation from 92 to 1072

> LD06441.hyp
MSSALTRLLERLPLKKQTAQSGIRVFSNQEQRQEIEDDEEFRVLSLRTVK
QQMQKRQQVRRDPITPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQG
FTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWPKGLE
TEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARD
KFLRLVGDRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEP
WEATKSEADMEVYLFERNQSKVSAEGILNWNAKKGAPKVVPSKSFAECVE
KLINEGENEYNLGKYKEEVKKMLNIA*

LD06441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS35-PA 326 CG2101-PA 1..326 1..326 1720 100 Plus

LD06441.pep Sequence

Translation from 92 to 1072

> LD06441.pep
MSSALTRLLERLPLKKQTAQSGIRVFSNQEQRQEIEDDEEFRVLSLRTVK
QQMQKRQQVRRDPITPPRTGRMAVDQDWTAVWPGPRSFHPASVPLPLRQG
FTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWPKGLE
TEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARD
KFLRLVGDRYNKDTDLVTFVTDRCPQKKQNYDYALYLLTACYHESFVTEP
WEATKSEADMEVYLFERNQSKVSAEGILNWNAKKGAPKVVPSKSFAECVE
KLINEGENEYNLGKYKEEVKKMLNIA*

LD06441.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24249-PA 327 GF24249-PA 1..325 1..326 1440 82.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14888-PA 328 GG14888-PA 1..328 1..326 1598 93.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16988-PA 328 GH16988-PA 1..327 1..326 1333 75.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS35-PA 326 CG2101-PA 1..326 1..326 1720 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11400-PA 328 GI11400-PA 1..327 1..326 1297 74.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22637-PA 331 GL22637-PA 1..328 1..325 1435 79.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15241-PA 331 GA15241-PA 1..328 1..325 1439 79.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14514-PA 327 GM14514-PA 1..327 1..326 1686 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13711-PA 182 GD13711-PA 28..182 172..326 785 94.2 Plus
Dsim\GD13710-PA 117 GD13710-PA 1..83 1..82 397 95.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13595-PA 328 GJ13595-PA 1..327 1..326 1346 76.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16569-PA 329 GK16569-PA 1..326 1..326 1391 76.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20339-PA 328 GE20339-PA 1..328 1..326 1567 92.7 Plus