Clone LD06553 Report

Search the DGRC for LD06553

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:65
Well:53
Vector:pBS SK-
Associated Gene/TranscriptCG3609-RA
Protein status:LD06553.pep: gold
Preliminary Size:1008
Sequenced Size:1127

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3609 2002-01-01 Sim4 clustering to Release 2
CG3609 2003-01-01 Sim4 clustering to Release 3
CG3609 2003-08-11 Blastp of sequenced clone
CG3609 2008-04-29 Release 5.5 accounting
CG3609 2008-08-15 Release 5.9 accounting
CG3609 2008-12-18 5.12 accounting

Clone Sequence Records

LD06553.complete Sequence

1127 bp (1127 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010300

> LD06553.complete
TTTAGTTCTGCTACAAGCTCAGCCCCGCTCCACAATCCAGCAACATGTCG
AAACTCATCCGTTGGGGAATCGCTTCCGCCGGCAAGATCAGCGAGGACTT
TGTCATCGCCCTCAGCACCCTGCCCTCCAGCGACCACAAGGTCCAGGCTG
TAGCCGCCCGAGCTCTTGATCGCGCCCAGGAGTTCGCCACCAAGCACGGC
ATTCCCAAGGCCCTCGGAAGCTACGAGGAGCTGGCCAAGAGCACCGATGT
CGATGTGGTCTACATTGGCACCCTGAATCCCCAGCACTACGAGGTCGCCT
TGCTGATGCTGAACAATGGCAAGCATGTTCTCTGCGAGAAGCCGTTGGCC
ATGAACAAGAAGCAGGTGGAGGGCATCCTGGCCGCTGCCAAGGCCAACAA
GCGCTTCTTCATGGAGGCCGTGTGGTCGCGATTCTTCCCCTCGTACCAGC
GCGTTAAGGAGCTCATCTCCAGCGGACAGCTGGGCCAAGTCAAGGATGTG
GAGGTCAACTTTGGCTTCCCTATGCCTCATGTCGACCGCTTGCAGAAACG
CGAACTGGGAGGCGGTGTGGTCTACGATCTGGGCATTTACACCATCCAGG
TCTCGCAGTGGGCCTTCCAGGAGAAACCGGAGAAGATCGAGTCCAAGGGA
ACCCTGAACGCCGAGGGCATCGACGATGATGTTAGTGCCACCTTGACCTA
CAGTGGTGGGCGCACTGCTCGCATGCGCTTCTCCTCCAAGGAGAAGTTGG
GAAACACCGCCGTTATCAAGGGCACCAAAGGACAAGTTACCCTGATTGAC
TTCTGGTCGCCCAACAAGCTCATCGACATCGATGGCCAGGAGAAGGAGTG
GCTGCCTCCCAAGGGCAAGTACGCGACCAACTACGCCAACTCCGAGGCCA
TGCGCTATGAGGCGGAGGCAGTGCGCCAGTCCATCATCGCCGGCGAAGTG
GAGAACAAGAACGTCACCTACGCCGACAGTTTGATCTTCGCCGAGATCGA
GGACACCATCCGCAAGCAGATCGGTGTGCTGAACAAGTACGATGAGCAGT
AAATATAGATTATATAGATAAACGTGTAAACCTAACATAATAAACAGAAC
TTTTTACAAAAAAAAAAAAAAAAAAAA

LD06553.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG3609.a 1359 CG3609.a 1..1113 1..1113 5565 100 Plus
CG3609-RA 1362 CG3609-RA 174..1286 1..1113 5565 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2372148..2372463 1107..792 1535 99.1 Minus
chr2L 23010047 chr2L 2372826..2373119 545..252 1440 99.3 Minus
chr2L 23010047 chr2L 2373188..2373416 252..24 1145 100 Minus
chr2L 23010047 chr2L 2372523..2372769 791..545 1130 97.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2372449..2372770 1113..792 1610 100 Minus
2L 23513712 2L 2373133..2373426 545..252 1470 100 Minus
2L 23513712 2L 2372830..2373076 791..545 1235 100 Minus
2L 23513712 2L 2373494..2373722 252..24 1145 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2372449..2372770 1113..792 1610 100 Minus
2L 23513712 2L 2373133..2373426 545..252 1470 100 Minus
2L 23513712 2L 2372830..2373076 791..545 1235 100 Minus
2L 23513712 2L 2373494..2373722 252..24 1145 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:14:47 has no hits.

LD06553.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:15:45 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2372148..2372463 792..1107 99 <- Minus
chr2L 2372523..2372769 545..791 97 <- Minus
chr2L 2372827..2373118 253..544 99 <- Minus
chr2L 2373188..2373416 24..252 100 <- Minus
chr2L 2374185..2374207 1..23 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:40 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 1..1008 45..1052 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:53:21 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RB 1..1008 45..1052 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:38:48 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 1..1008 45..1052 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:46 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 1..1008 45..1052 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:37 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 1..1008 45..1052 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:49 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 1..1052 1..1052 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:53:21 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 43..1149 1..1107 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:48 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 117..1223 1..1107 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:46 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 1..1052 1..1052 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:37 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
CG3609-RA 117..1223 1..1107 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:45 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2372455..2372770 792..1107 100 <- Minus
2L 2372830..2373076 545..791 100 <- Minus
2L 2373134..2373425 253..544 100 <- Minus
2L 2373494..2373722 24..252 100 <- Minus
2L 2374489..2374511 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:45 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2372455..2372770 792..1107 100 <- Minus
2L 2372830..2373076 545..791 100 <- Minus
2L 2373134..2373425 253..544 100 <- Minus
2L 2373494..2373722 24..252 100 <- Minus
2L 2374489..2374511 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:45 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2372455..2372770 792..1107 100 <- Minus
2L 2372830..2373076 545..791 100 <- Minus
2L 2373134..2373425 253..544 100 <- Minus
2L 2373494..2373722 24..252 100 <- Minus
2L 2374489..2374511 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:48 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2373494..2373722 24..252 100 <- Minus
arm_2L 2374489..2374511 1..23 100   Minus
arm_2L 2372455..2372770 792..1107 100 <- Minus
arm_2L 2372830..2373076 545..791 100 <- Minus
arm_2L 2373134..2373425 253..544 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:53:03 Download gff for LD06553.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2373494..2373722 24..252 100 <- Minus
2L 2374489..2374511 1..23 100   Minus
2L 2372455..2372770 792..1107 100 <- Minus
2L 2372830..2373076 545..791 100 <- Minus
2L 2373134..2373425 253..544 100 <- Minus

LD06553.pep Sequence

Translation from 44 to 1051

> LD06553.pep
MSKLIRWGIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATK
HGIPKALGSYEELAKSTDVDVVYIGTLNPQHYEVALLMLNNGKHVLCEKP
LAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSYQRVKELISSGQLGQVK
DVEVNFGFPMPHVDRLQKRELGGGVVYDLGIYTIQVSQWAFQEKPEKIES
KGTLNAEGIDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTKGQVTL
IDFWSPNKLIDIDGQEKEWLPPKGKYATNYANSEAMRYEAEAVRQSIIAG
EVENKNVTYADSLIFAEIEDTIRKQIGVLNKYDEQ*

LD06553.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15278-PA 335 GF15278-PA 1..335 1..335 1648 91 Plus
Dana\GF15279-PA 336 GF15279-PA 7..331 5..328 698 42.2 Plus
Dana\GF14543-PA 491 GF14543-PA 98..419 4..328 649 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24525-PA 335 GG24525-PA 1..335 1..335 1734 96.4 Plus
Dere\GG24526-PA 335 GG24526-PA 7..332 5..329 707 42.6 Plus
Dere\GG20106-PA 472 GG20106-PA 92..412 5..328 632 38.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13782-PA 337 GH13782-PA 5..337 3..335 1468 82.6 Plus
Dgri\GH13961-PA 219 GH13961-PA 1..219 117..335 994 82.6 Plus
Dgri\GH13784-PA 340 GH13784-PA 3..334 2..334 691 42.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3609-PC 335 CG3609-PC 1..335 1..335 1712 100 Plus
CG3609-PB 335 CG3609-PB 1..335 1..335 1712 100 Plus
CG3609-PA 335 CG3609-PA 1..335 1..335 1712 100 Plus
CG3597-PA 335 CG3597-PA 7..332 5..329 670 42 Plus
CG3597-PB 337 CG3597-PB 7..334 5..329 658 41.8 Plus
CG13280-PB 419 CG13280-PB 38..358 5..328 597 38.3 Plus
CG13280-PA 473 CG13280-PA 92..412 5..328 597 38.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17186-PA 337 GI17186-PA 5..337 3..335 1513 86.2 Plus
Dmoj\GI17187-PA 340 GI17187-PA 3..333 2..333 723 44.1 Plus
Dmoj\GI17180-PA 361 GI17180-PA 27..347 5..328 551 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19398-PA 335 GL19398-PA 1..335 1..335 1584 87.2 Plus
Dper\GL19399-PA 336 GL19399-PA 7..335 5..334 711 42 Plus
Dper\GL19331-PA 412 GL19331-PA 48..369 3..328 640 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17556-PA 335 GA17556-PA 1..335 1..335 1584 87.2 Plus
Dpse\GA17547-PA 336 GA17547-PA 7..335 5..334 711 42 Plus
Dpse\GA12167-PA 460 GA12167-PA 96..417 3..328 640 38.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18233-PA 335 GM18233-PA 1..335 1..335 1737 96.7 Plus
Dsec\GM18234-PA 335 GM18234-PA 7..334 5..333 688 42.4 Plus
Dsec\GM17156-PA 467 GM17156-PA 87..407 5..328 641 39 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22839-PA 312 GD22839-PA 1..312 1..335 1588 90.4 Plus
Dsim\GD22840-PA 335 GD22840-PA 7..334 5..333 694 42.7 Plus
Dsim\GD11964-PA 418 GD11964-PA 38..358 5..328 644 39.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22204-PA 337 GJ22204-PA 5..337 3..335 1482 85.6 Plus
Dvir\GJ22215-PA 340 GJ22215-PA 3..334 2..334 735 44 Plus
Dvir\GJ22128-PA 325 GJ22128-PA 1..309 15..326 567 35.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14982-PA 334 GK14982-PA 1..334 1..334 1626 90.1 Plus
Dwil\GK16411-PA 336 GK16411-PA 3..336 2..335 1360 74 Plus
Dwil\GK14983-PA 338 GK14983-PA 6..334 2..328 686 42.6 Plus
Dwil\GK18155-PA 462 GK18155-PA 74..393 5..328 621 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15118-PA 335 GE15118-PA 1..335 1..335 1740 96.4 Plus
Dyak\GE15120-PA 335 GE15120-PA 7..334 5..333 689 42.4 Plus
Dyak\GE13162-PA 472 GE13162-PA 92..412 5..328 639 38.7 Plus

LD06553.hyp Sequence

Translation from 44 to 1051

> LD06553.hyp
MSKLIRWGIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATK
HGIPKALGSYEELAKSTDVDVVYIGTLNPQHYEVALLMLNNGKHVLCEKP
LAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSYQRVKELISSGQLGQVK
DVEVNFGFPMPHVDRLQKRELGGGVVYDLGIYTIQVSQWAFQEKPEKIES
KGTLNAEGIDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTKGQVTL
IDFWSPNKLIDIDGQEKEWLPPKGKYATNYANSEAMRYEAEAVRQSIIAG
EVENKNVTYADSLIFAEIEDTIRKQIGVLNKYDEQ*

LD06553.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3609-PC 335 CG3609-PC 1..335 1..335 1712 100 Plus
CG3609-PB 335 CG3609-PB 1..335 1..335 1712 100 Plus
CG3609-PA 335 CG3609-PA 1..335 1..335 1712 100 Plus
CG3597-PA 335 CG3597-PA 7..332 5..329 670 42 Plus
CG3597-PB 337 CG3597-PB 7..334 5..329 658 41.8 Plus