Clone LD06574 Report

Search the DGRC for LD06574

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:65
Well:74
Vector:pBS SK-
Associated Gene/TranscriptKdelR-RA
Protein status:LD06574.pep: gold
Preliminary Size:1265
Sequenced Size:1092

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5183 2001-01-01 Release 2 assignment
CG5183 2002-11-12 Blastp of sequenced clone
CG5183 2003-01-01 Sim4 clustering to Release 3
KdelR 2008-04-29 Release 5.5 accounting
KdelR 2008-08-15 Release 5.9 accounting
KdelR 2008-12-18 5.12 accounting

Clone Sequence Records

LD06574.complete Sequence

1092 bp (1092 high quality bases) assembled on 2002-11-12

GenBank Submission: AF132559

> LD06574.complete
CAGTGGCCATGTTATCAAACTTATTCTTATTCATCAGCCACGTCATTGTT
TATGCCGACATTCTGACAAGTTTTTTTCCGAAGCGGCAAAGCCCTCACAT
CTCTACTCGTTGGCAAATTAGGCGAAAAGTCATTTTGGCGTGCGTTCCGT
GACGCAGCCGCAGCGAAAGGAAGTAGAACAATCAAACAGCCAACCGGGCA
GCCAAGTAGCCAAGTCGGCGGATTAGATCACGATGAATATCTTTCGCTTT
GCTGGGGATCTGTCGCATGTGTTTGCCATCATAATACTGCTGCTGAAGAT
ATGGAAGACCCGCTCGTGCGCCGGAATATCGGGCAAGTCGCAGATCCTGT
TCGCCGTGGTCTATCTGACGCGCTACCTGGATCTGTTCACCACCTACGTG
AGCCTGTACAACTCGGTGATGAAGGTGTTGTTCCTGGCCACGTCCGGTGC
CACCGTGTATTTGATGTACGTGAAGTTTAAGGCCACCTATGACCACAATC
ACGATTCGTTCCGCATCGAATTCCTGCTGGTGCCGTGCGCCCTGCTCTCG
CTGGTGATCAATCATGAGTTTACCGTGATGGAAGTGCTGTGGACATTCTC
GATCTATTTGGAATCGGTGGCCATTCTGCCGCAGCTGTTCCTAGTGAGCA
GAACCGGCGAGGCCGAGTCCATCACCAGCCACTACCTCTTCGCCCTGGGA
TCGTACCGTGCACTCTACTTGCTCAACTGGGTCTACCGGTACATGGTCGA
GTCGCACTACGACCTTATCGCGATCTTCGCCGGAGTTGTCCAGACCGTCT
TGTACTGCGACTTCTTCTACTTATACATTACCAAAGTTCTTAAGGGCAAG
AAGCTCCAGCTGCCGGCATAAGCGGATGATGGATAAGTGCATAGATGTGG
GACATTTGTGTTTTGTCGGCACACATCATCAATCGACGTCAGAGTAAACA
AGCGAGCGATCCACGGCCCGTTTGACAACGCGTATTTCGTTCATATTATA
CAAAAGATACATAATCGAGGGGAGCGCCTAAGTTGTAATTATTTAATGAG
AAATAAACCGAAAATCGAAAGTAAAAAAAAAAAAAAAAAAAA

LD06574.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
KdelR-RB 1293 KdelR-RB 202..1145 130..1073 4690 99.7 Plus
KdelR.a 1244 KdelR.a 153..1096 130..1073 4690 99.7 Plus
KdelR-RC 1323 KdelR-RC 146..1081 138..1073 4680 100 Plus
KdelR-RB 1293 KdelR-RB 1..138 1..138 690 100 Plus
KdelR-RC 1323 KdelR-RC 4..141 1..138 690 100 Plus
KdelR.a 1244 KdelR.a 1..137 1..137 685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10425902..10426844 130..1072 4670 99.7 Plus
chr2L 23010047 chr2L 10425701..10425838 1..138 690 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10427068..10428011 130..1073 4690 99.8 Plus
2L 23513712 2L 10426867..10427004 1..138 690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10427068..10428011 130..1073 4690 99.7 Plus
2L 23513712 2L 10426867..10427004 1..138 690 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:00:11 has no hits.

LD06574.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:01:14 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10425701..10425837 1..137 100 -> Plus
chr2L 10425910..10426844 138..1072 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:47 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..639 233..871 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:21 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..639 233..871 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:24:09 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RB 1..639 233..871 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:26 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..639 233..871 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:52:30 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..639 233..871 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:48 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:21 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:24:09 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..1052 21..1072 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:26 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:52:30 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
KdelR-RA 1..1052 21..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:14 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10426867..10427003 1..137 100 -> Plus
2L 10427076..10428010 138..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:14 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10426867..10427003 1..137 100 -> Plus
2L 10427076..10428010 138..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:14 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10426867..10427003 1..137 100 -> Plus
2L 10427076..10428010 138..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:24:09 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10426867..10427003 1..137 100 -> Plus
arm_2L 10427076..10428010 138..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:47 Download gff for LD06574.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10427076..10428010 138..1072 100   Plus
2L 10426867..10427003 1..137 100 -> Plus

LD06574.pep Sequence

Translation from 232 to 870

> LD06574.pep
MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLD
LFTTYVSLYNSVMKVLFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLV
PCALLSLVINHEFTVMEVLWTFSIYLESVAILPQLFLVSRTGEAESITSH
YLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDFFYLYIT
KVLKGKKLQLPA*

LD06574.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15788-PA 212 GF15788-PA 1..212 1..212 1092 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10131-PA 212 GG10131-PA 1..212 1..212 1100 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13610-PA 212 GH13610-PA 1..212 1..212 1089 97.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
KdelR-PC 212 CG5183-PC 1..212 1..212 1084 100 Plus
KdelR-PB 212 CG5183-PB 1..212 1..212 1084 100 Plus
KdelR-PA 212 CG5183-PA 1..212 1..212 1084 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20444-PA 212 GI20444-PA 1..212 1..212 1092 98.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19001-PA 212 GL19001-PA 1..212 1..212 1087 97.2 Plus
Dper\GL25745-PA 212 GL25745-PA 1..212 1..212 914 78.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18717-PA 212 GA18717-PA 1..212 1..212 1087 97.2 Plus
Dpse\GA25416-PA 212 GA25416-PA 1..212 1..212 914 78.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18383-PA 212 GM18383-PA 1..212 1..212 1103 100 Plus
Dsec\GM19318-PA 129 GM19318-PA 1..129 84..212 674 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23700-PA 195 GD23700-PA 1..195 1..212 987 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13786-PA 212 GJ13786-PA 1..212 1..212 1090 97.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14877-PA 212 GK14877-PA 1..212 1..212 1085 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18943-PA 212 GE18943-PA 1..212 1..212 1100 99.5 Plus

LD06574.hyp Sequence

Translation from 232 to 870

> LD06574.hyp
MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLD
LFTTYVSLYNSVMKVLFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLV
PCALLSLVINHEFTVMEVLWTFSIYLESVAILPQLFLVSRTGEAESITSH
YLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDFFYLYIT
KVLKGKKLQLPA*

LD06574.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
KdelR-PC 212 CG5183-PC 1..212 1..212 1084 100 Plus
KdelR-PB 212 CG5183-PB 1..212 1..212 1084 100 Plus
KdelR-PA 212 CG5183-PA 1..212 1..212 1084 100 Plus