Clone LD06785 Report

Search the DGRC for LD06785

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:67
Well:85
Vector:pBS SK-
Associated Gene/Transcripttsr-RA
Protein status:LD06785.pep: gold
Sequenced Size:709

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
tsr 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

LD06785.complete Sequence

709 bp assembled on 2009-07-31

GenBank Submission: BT089017.1

> LD06785.complete
AGAAGGCGGAAGGTTAAACAGTATTTGTAAAATATATACTCGGCGAAGCA
GCAATTTGAGAATTGTGAAAGCGAAAAACTACAGGAAAAATGGCTTCTGG
TGTAACTGTGTCTGATGTCTGCAAGACTACATACGAGGAAATAAAGAAGG
ACAAAAAGCATCGCTATGTCATCTTTTACATTCGCGATGAAAAGCAGATT
GATGTGGAGACTGTGGCAGATCGCAACGCCGAGTACGACCAGTTTCTAGA
AGATATCCAGAAATGCGGACCTGGAGAGTGCCGGTACGGACTGTTCGATT
TCGAGTACATGCACCAGTGTCAAGGCACCTCTGAGAGTTCAAAGAAGCAA
AAGCTGTTCCTTATGTCGTGGTGTCCCGATACTGCCAAGGTCAAGAAGAA
GATGTTGTACTCCAGCTCCTTCGATGCTCTCAAGAAGTCGCTCGTGGGCG
TCCAAAAGTATATACAAGCCACTGATCTTTCCGAAGCCTCCCGGGAAGCC
GTCGAGGAGAAACTCCGGGCCACCGACCGCCAATAAACTGTACGAGCACT
GTGCATTGCATTTAACAAACAAGGCATGCATGAAACAGCGATGGAAACAC
GTATCCTGTTGAGATCGCCAATTTGTATGAGAATTTTCTACATAATTTGT
ATTTTCAGTAGAAATAAAGAATGAAATATTTAACTTGAAAAAAAAAAAAA
AAAAAAAAA

LD06785.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
tsr-RA 969 tsr-RA 227..914 1..688 3440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19930483..19930782 687..388 1485 99.7 Minus
chr2R 21145070 chr2R 19931019..19931213 286..92 975 100 Minus
chr2R 21145070 chr2R 19930842..19930950 391..283 545 100 Minus
chr2R 21145070 chr2R 19932695..19932787 93..1 465 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24044452..24044752 688..388 1505 100 Minus
2R 25286936 2R 24044989..24045183 286..92 975 100 Minus
2R 25286936 2R 24044812..24044920 391..283 545 100 Minus
2R 25286936 2R 24046665..24046757 93..1 465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24045651..24045951 688..388 1505 100 Minus
2R 25260384 2R 24046188..24046382 286..92 975 100 Minus
2R 25260384 2R 24046011..24046119 391..283 545 100 Minus
2R 25260384 2R 24047864..24047956 93..1 465 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:09:06 has no hits.

LD06785.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:10:28 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19930483..19930780 390..687 99 <- Minus
chr2R 19930844..19930949 284..389 100 <- Minus
chr2R 19931022..19931212 93..283 100 <- Minus
chr2R 19932696..19932787 1..92 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:34 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 1..447 90..536 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:50 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 1..447 90..536 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:38:42 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 1..447 90..536 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:44:31 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 1..447 90..536 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-31 13:13:23 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 80..766 1..687 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:50 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 80..766 1..687 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:38:42 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 49..735 1..687 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:44:31 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
tsr-RA 49..735 1..687 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:28 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24044453..24044750 390..687 100 <- Minus
2R 24044814..24044919 284..389 100 <- Minus
2R 24044992..24045182 93..283 100 <- Minus
2R 24046666..24046757 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:28 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24044453..24044750 390..687 100 <- Minus
2R 24044814..24044919 284..389 100 <- Minus
2R 24044992..24045182 93..283 100 <- Minus
2R 24046666..24046757 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:28 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24044453..24044750 390..687 100 <- Minus
2R 24044814..24044919 284..389 100 <- Minus
2R 24044992..24045182 93..283 100 <- Minus
2R 24046666..24046757 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:38:42 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19931976..19932273 390..687 100 <- Minus
arm_2R 19932337..19932442 284..389 100 <- Minus
arm_2R 19932515..19932705 93..283 100 <- Minus
arm_2R 19934189..19934280 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:37 Download gff for LD06785.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24045670..24045967 390..687 100 <- Minus
2R 24046031..24046136 284..389 100 <- Minus
2R 24046209..24046399 93..283 100 <- Minus
2R 24047883..24047974 1..92 100   Minus

LD06785.hyp Sequence

Translation from 89 to 535

> LD06785.hyp
MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYD
QFLEDIQKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAK
VKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASREAVEEKLRATDRQ*

LD06785.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
tsr-PA 148 CG4254-PA 1..148 1..148 771 100 Plus
CG6873-PA 148 CG6873-PA 1..148 1..148 434 52.7 Plus

LD06785.pep Sequence

Translation from 89 to 535

> LD06785.pep
MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYD
QFLEDIQKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAK
VKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASREAVEEKLRATDRQ*

LD06785.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13484-PA 148 GF13484-PA 1..148 1..148 782 100 Plus
Dana\GF19223-PA 148 GF19223-PA 1..147 1..147 438 54.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19959-PA 148 GG19959-PA 1..148 1..148 782 100 Plus
Dere\GG18095-PA 148 GG18095-PA 1..148 1..148 443 54.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20162-PA 418 GH20162-PA 272..418 2..148 781 98.6 Plus
Dgri\GH12530-PA 148 GH12530-PA 1..147 1..147 462 56.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
tsr-PA 148 CG4254-PA 1..148 1..148 771 100 Plus
CG6873-PA 148 CG6873-PA 1..148 1..148 434 52.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20679-PA 156 GI20679-PA 10..156 2..148 769 98.6 Plus
Dmoj\GI11187-PA 148 GI11187-PA 1..148 1..148 487 61.5 Plus
Dmoj\GI11766-PA 148 GI11766-PA 10..138 11..139 302 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10428-PA 150 GL10428-PA 4..150 2..148 772 99.3 Plus
Dper\GL27011-PA 152 GL27011-PA 1..151 1..147 353 43 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18060-PA 154 GA18060-PA 8..154 2..148 775 99.3 Plus
Dpse\GA22341-PA 152 GA22341-PA 1..151 1..147 349 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18279-PA 148 GM18279-PA 1..148 1..148 782 100 Plus
Dsec\GM22788-PA 148 GM22788-PA 1..148 1..148 437 52 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24977-PA 148 GD24977-PA 1..148 1..148 782 100 Plus
Dsim\GD15622-PA 68 GD15622-PA 6..68 86..148 199 60.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21900-PA 148 GJ21900-PA 1..148 1..148 775 98.6 Plus
Dvir\GJ19548-PA 148 GJ19548-PA 1..148 1..148 498 62.8 Plus
Dvir\GJ13471-PA 148 GJ13471-PA 2..143 3..144 315 44.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10641-PA 149 GK10641-PA 3..149 2..148 771 99.3 Plus
Dwil\GK24946-PA 150 GK24946-PA 3..149 1..147 472 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\tsr-PA 148 GE11491-PA 1..148 1..148 782 100 Plus
Dyak\GE15494-PA 148 GE15494-PA 1..148 1..148 445 53.4 Plus