Clone LD06837 Report

Search the DGRC for LD06837

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:68
Well:37
Vector:pBS SK-
Associated Gene/TranscriptRfC38-RA
Protein status:LD06837.pep: gold
Preliminary Size:1242
Sequenced Size:1266

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6258 2001-01-01 Release 2 assignment
CG6258 2002-12-11 Blastp of sequenced clone
CG6258 2003-01-01 Sim4 clustering to Release 3
RfC38 2008-04-29 Release 5.5 accounting
RfC38 2008-08-15 Release 5.9 accounting
RfC38 2008-12-18 5.12 accounting

Clone Sequence Records

LD06837.complete Sequence

1266 bp (1266 high quality bases) assembled on 2002-12-11

GenBank Submission: AF160912

> LD06837.complete
ACTAGAAATAGTCAGCGGAAAAGGCGCGCATTAAATTGTTTTGTTAAATT
ACTTTTACGGTCAGAAAGTAACTTAAAATACATCCAATTACTATCGTATT
TTACATGCGTTAACGAAATGGCACTTTGGGTGGATAAATACCGTCCGCGG
GAGCTGTCCAAATTGGACTTCCACAAGGATCAAGCGGAGAACCTACGCAA
CCTTTGCAAGCAGAGCGATTTTCCTCATCTGATGTTCTACGGACCCTCGG
GTGCTGGCAAGAAGACACGCATCATGTGCCTGCTACGGGAGATGTACGGA
TCCGGCGTTGAGCGGTTGAGGAGCGAGACCATGACATTCACCACGCCATC
CAATCGGAAGGTAGAGGTGATGACGGTCAGCAGCAACTACCACTTGGAGG
TGAATCCCTCCGACGCTGGCATGTACGACCGCACGGTGGTGATCGATCTC
ATCAAGCAGGTGGCCCAGACGCATCAAATTGAGATTAGTGGCCAACGGGA
ATTCAAGGTGATTGTAATTTCGGAGGGCGACGAACTCACCAAGGATGCCC
AGCACGCCCTGCGCCGTACGATGGAGAAATATGTGGCCACGTGCCGGATA
ATCATATCGGTGAACTCCACATCTCGGATCATTCCGGCCATACGGTCGCG
TTGCCTGGGCATACGGGTGGCGGCTCCCAACGAAACGGAGATCGTGTCCA
TCTTGCAGAACACTTGCAAGCGGGAGGGACTCGCACTGCCCGTGGAGCTG
GCCAAACGGGTTGTGGACAAGTCGGAGCGCAATCTCAGGCGAGCACTTTT
GATGCTGGAGGCCGCCAAGGTGGCCAAGGCGCCGTTTACCGCCAATCAGG
AGATTCCCGACCTGGACTGGCAGGTGTTCCTGCGTGAGACAGCATCTCAG
ATTATCAGTGAGCAAACGCCTGCCAAACTGGAGAAGATCCGCGAACGCCT
GTACGAGCTACTCACGCAAGGCGTTCCACCTAATCTCATATTCCGCGGCC
TGGTCGAACAGCTGGTTAACAATTGTGATATGTCCATCAAGGCAAAGACG
CTCGAGTTCGCCACCGAGTACGAGCACCGGATGCAGTCCGGCGCCAAGCA
CATTTTTCATCTTGAAGCGTTCGTCGCTCAGTTTATGAACATCTATAAAA
AGTTCCTTTCTGAGCTGGACATGACGGATGATTTTTAAACGATTTACACG
CTTTAGCATTTAATTCAAAAAACTTATTAAATAAACTGATTTAAACGAAA
AAAAAAAAAAAAAAAA

LD06837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
RfC38-RA 1606 RfC38-RA 358..1606 1..1249 6245 100 Plus
Nup160-RA 4790 Nup160-RA 4348..4790 1249..807 2215 100 Minus
Nup160.a 4732 Nup160.a 4327..4732 1249..844 2030 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11127687..11128758 1247..176 5360 100 Minus
chr2L 23010047 chr2L 11128866..11129043 178..1 890 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11128930..11130003 1249..176 5370 100 Minus
2L 23513712 2L 11130111..11130288 178..1 890 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11128930..11130003 1249..176 5370 100 Minus
2L 23513712 2L 11130111..11130288 178..1 890 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:08:03 has no hits.

LD06837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:09:09 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11127687..11128756 178..1247 100 <- Minus
chr2L 11128867..11129043 1..177 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:55 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 1..1071 118..1188 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:59:55 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 1..1071 118..1188 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:38 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 1..1071 118..1188 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:50:30 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 1..1071 118..1188 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:54 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 1..1071 118..1188 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:16:58 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 358..1604 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:59:55 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 358..1604 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:38 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 30..1276 1..1247 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:50:30 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 358..1604 1..1247 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:54 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
RfC38-RA 30..1276 1..1247 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:09 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11128932..11130001 178..1247 100 <- Minus
2L 11130112..11130288 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:09 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11128932..11130001 178..1247 100 <- Minus
2L 11130112..11130288 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:09 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11128932..11130001 178..1247 100 <- Minus
2L 11130112..11130288 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:38 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11128932..11130001 178..1247 100 <- Minus
arm_2L 11130112..11130288 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:22:14 Download gff for LD06837.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11128932..11130001 178..1247 100 <- Minus
2L 11130112..11130288 1..177 100   Minus

LD06837.hyp Sequence

Translation from 0 to 1187

> LD06837.hyp
TRNSQRKRRALNCFVKLLLRSESNLKYIQLLSYFTCVNEMALWVDKYRPR
ELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYG
SGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDL
IKQVAQTHQIEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRI
IISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQNTCKREGLALPVEL
AKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLDWQVFLRETASQ
IISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLVNNCDMSIKAKT
LEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELDMTDDF*

LD06837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
RfC38-PB 356 CG6258-PB 1..356 40..395 1810 100 Plus
RfC38-PA 356 CG6258-PA 1..356 40..395 1810 100 Plus
RfC3-PA 332 CG5313-PA 13..321 43..378 267 25.9 Plus
CG8142-PA 353 CG8142-PA 30..245 41..278 267 29 Plus
RfC4-PA 331 CG14999-PA 18..228 43..281 235 27.6 Plus

LD06837.pep Sequence

Translation from 117 to 1187

> LD06837.pep
MALWVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKT
RIMCLLREMYGSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDA
GMYDRTVVIDLIKQVAQTHQIEISGQREFKVIVISEGDELTKDAQHALRR
TMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSILQNTC
KREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPFTANQEIPDLD
WQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLV
NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSEL
DMTDDF*

LD06837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14225-PA 356 GF14225-PA 1..356 1..356 1821 94.1 Plus
Dana\GF21175-PA 352 GF21175-PA 30..340 3..332 291 27.6 Plus
Dana\GF15785-PA 332 GF15785-PA 13..217 4..236 265 30.2 Plus
Dana\GF23886-PA 331 GF23886-PA 18..218 4..232 236 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10322-PA 356 GG10322-PA 1..356 1..356 1881 98 Plus
Dere\GG18160-PA 353 GG18160-PA 30..245 2..239 273 29 Plus
Dere\GG10129-PA 332 GG10129-PA 13..217 4..236 269 30.2 Plus
Dere\GG14218-PA 331 GG14218-PA 18..228 4..242 237 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10966-PA 356 GH10966-PA 1..356 1..356 1761 89.6 Plus
Dgri\GH18198-PA 356 GH18198-PA 33..255 2..245 280 29.4 Plus
Dgri\GH13305-PA 332 GH13305-PA 13..217 4..236 272 31.1 Plus
Dgri\GH15919-PA 331 GH15919-PA 18..218 4..232 234 27.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
RfC38-PB 356 CG6258-PB 1..356 1..356 1810 100 Plus
RfC38-PA 356 CG6258-PA 1..356 1..356 1810 100 Plus
RfC3-PA 332 CG5313-PA 13..321 4..339 267 25.9 Plus
CG8142-PA 353 CG8142-PA 30..245 2..239 267 29 Plus
RfC4-PA 331 CG14999-PA 18..228 4..242 235 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18150-PA 356 GI18150-PA 1..356 1..356 1757 88.5 Plus
Dmoj\GI18168-PA 332 GI18168-PA 13..217 4..236 281 31.5 Plus
Dmoj\GI10150-PA 354 GI10150-PA 31..240 2..233 275 29.7 Plus
Dmoj\GI16571-PA 331 GI16571-PA 18..218 4..232 239 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18586-PA 356 GL18586-PA 1..356 1..356 1824 93.8 Plus
Dper\GL14564-PA 354 GL14564-PA 31..342 2..332 275 27.5 Plus
Dper\GL19009-PA 333 GL19009-PA 13..217 4..236 269 31.5 Plus
Dper\GL12737-PA 331 GL12737-PA 18..218 4..232 250 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19473-PA 356 GA19473-PA 1..356 1..356 1824 93.8 Plus
Dpse\GA25212-PA 333 GA25212-PA 13..217 4..236 273 31.9 Plus
Dpse\GA20846-PA 354 GA20846-PA 31..342 2..332 269 27.2 Plus
Dpse\GA13416-PA 331 GA13416-PA 18..218 4..232 250 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11127-PA 351 GM11127-PA 1..349 1..348 1848 99.1 Plus
Dsec\GM18361-PA 332 GM18361-PA 13..217 4..236 269 30.2 Plus
Dsec\GM22851-PA 326 GM22851-PA 30..226 2..220 238 27.4 Plus
Dsec\GM14011-PA 331 GM14011-PA 18..228 4..242 236 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22189-PA 227 GD22189-PA 1..208 1..208 1123 100 Plus
Dsim\GD22190-PA 128 GD22190-PA 1..128 229..356 678 99.2 Plus
Dsim\GD23698-PA 332 GD23698-PA 13..217 4..236 269 30.2 Plus
Dsim\GD13291-PA 331 GD13291-PA 18..228 4..242 236 27.6 Plus
Dsim\GD15662-PA 208 GD15662-PA 1..100 140..239 158 38 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14536-PA 356 GJ14536-PA 1..356 1..356 1757 89 Plus
Dvir\GJ23369-PA 356 GJ23369-PA 33..255 2..245 287 30.2 Plus
Dvir\GJ14606-PA 332 GJ14606-PA 13..217 4..236 274 30.6 Plus
Dvir\GJ12823-PA 331 GJ12823-PA 18..218 4..232 239 27.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15241-PA 356 GK15241-PA 1..356 1..356 1768 89.6 Plus
Dwil\GK15259-PA 331 GK15259-PA 12..216 4..236 283 31.5 Plus
Dwil\GK25619-PA 355 GK25619-PA 31..343 2..332 265 26.2 Plus
Dwil\GK10084-PA 333 GK10084-PA 20..220 4..232 234 27.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12972-PA 356 GE12972-PA 1..356 1..356 1895 98.9 Plus
Dyak\GE15569-PA 353 GE15569-PA 30..245 2..239 271 28.6 Plus
Dyak\GE18941-PA 332 GE18941-PA 13..217 4..236 270 30.2 Plus
Dyak\GE20646-PA 331 GE20646-PA 18..228 4..242 238 27.6 Plus