Clone LD06929 Report

Search the DGRC for LD06929

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:69
Well:29
Vector:pBS SK-
Associated Gene/TranscriptCG9948-RA
Protein status:LD06929.pep: gold
Preliminary Size:1411
Sequenced Size:1233

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9948 2001-01-01 Release 2 assignment
CG9948 2002-05-30 Blastp of sequenced clone
CG9948 2003-01-01 Sim4 clustering to Release 3
CG9948 2008-04-29 Release 5.5 accounting
CG9948 2008-08-15 Release 5.9 accounting
CG9948 2008-12-18 5.12 accounting

Clone Sequence Records

LD06929.complete Sequence

1233 bp (1233 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118496

> LD06929.complete
CTCAAGCAAGGGATTCTTAATTATCAAGTTCAAGCTAGTTTAATTCAATT
TGGTAGCCATGCGCACCAGTTACAAGAAAAACAGACCTTTCGACTTCAAG
CTAATTGATCTGGTGGAACCCAATCCTGTGCTCTATAAGAGATCTGGACT
CTCGAACTACGATGCCATGAAGGCGAAAACCGATATCTGGGCTCGCATAG
CCGAGATGATGGGCTGTGATGTGGACTTCTGCCTGATGCGCTGGAACAAT
CTGCACTATCAGTTTCGCAAGGAGTTTCGCCGCGCGGACACCAGTGGATC
CACCTGGCCGTACCTGGAACGCCTGCGATTTTTGGCCGAGATCCAGCCGC
CCTCCAAAGTGAAAACCAAACCCAAAACAAACAAACAGGAGGCGACCATC
CAGACGGAAACTCCTGTGCAATTTTTGTGGGACACTTTTGAGGATGGGGA
TGTTCCACAGCAGTCGAGTACGTTCATAATCGAGGAGGTCATCGAGGAGC
CCAGTGAACAGATCATCCAAGAGGAAATCATCTACGAGGAACAAGAGCCC
GCTGAAATAATCTCGCCCAGAAGCAGCTTTCTCCAGATGGACCAAATACT
GGCCCAACTAAAGGAACCGCAGCGGAGAAGGGCAGAACGAAGGATTACAG
CATTTCTGCTCAAGTGCCAGCTGCGTGCCTTGAGTAATCAGTCCGTGGAG
GACCTTAGCATCTAGTTTCCAGTTCACATACTCTCAAACTTTATTTTTAA
AAAACAGAATATAACTAAGATTAAACCTTGCACTTGTCCAATTCCAACCA
TGCCACTTTCGGCTTGACAATGAACTGATCGCGCGGCAAACTGTCCAGCA
TGCTGGCCTGCTGGCGGACGTACTTCACCAGTCGCTCGATCTGCGCGTAA
TCATCACAGTTCATCTCGAAGAAGCGGCGCCACAAGGCGCAGGCCAAAAC
CCGATCGTCGGACATGATGCCCTCGTCGTAGGCGATTAGGGCCGCTTGGA
ACTGCTCGGATAAGGTCTCGATTTGCTGACGGGTGCGTGAAGGATTGTGA
GCCTGTTGGGAAACACATATGAAGAGCATAAAGATTATATATATAAAGGT
GAACTAAAGTAAAACCTACTCCCAATTTCTTGGCGCGTGTGTTAACATCT
CCCCACATCGCCTCCACAATGCAGTTGCGCAGGAAGCGTCCATCCTCGCC
CGTTTCGGTAAAAAAAAAAAAAAAAAAAAAAAA

LD06929.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG9948-RA 1503 CG9948-RA 158..1365 1..1208 6040 100 Plus
CG9948.c 1243 CG9948.c 67..1243 32..1208 5885 100 Plus
CG9948.a 1239 CG9948.a 68..1239 37..1208 5860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6948744..6949731 221..1208 4940 100 Plus
chr3L 24539361 chr3L 6948471..6948688 4..221 1090 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6956453..6957440 221..1208 4940 100 Plus
3L 28110227 3L 6956177..6956397 1..221 1105 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6949553..6950540 221..1208 4940 100 Plus
3L 28103327 3L 6949277..6949497 1..221 1105 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:17:09 has no hits.

LD06929.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:18:10 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6948468..6948688 1..221 99 -> Plus
chr3L 6948745..6949731 222..1209 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:38:58 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 1..657 59..715 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:37:17 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 1..657 59..715 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:50:57 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 1..657 59..715 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:52 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 1..657 59..715 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:01 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 1..657 59..715 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:09:42 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 18..1225 1..1208 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:37:16 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 27..1234 1..1208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:57 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RB 187..1394 1..1208 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:53 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RA 18..1225 1..1208 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:01 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
CG9948-RB 187..1394 1..1208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:10 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6956177..6956397 1..221 100 -> Plus
3L 6956454..6957440 222..1209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:10 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6956177..6956397 1..221 100 -> Plus
3L 6956454..6957440 222..1209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:10 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6956177..6956397 1..221 100 -> Plus
3L 6956454..6957440 222..1209 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:57 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6949277..6949497 1..221 100 -> Plus
arm_3L 6949554..6950540 222..1209 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:28 Download gff for LD06929.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6949277..6949497 1..221 100 -> Plus
3L 6949554..6950540 222..1209 99   Plus

LD06929.pep Sequence

Translation from 58 to 714

> LD06929.pep
MRTSYKKNRPFDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEM
MGCDVDFCLMRWNNLHYQFRKEFRRADTSGSTWPYLERLRFLAEIQPPSK
VKTKPKTNKQEATIQTETPVQFLWDTFEDGDVPQQSSTFIIEEVIEEPSE
QIIQEEIIYEEQEPAEIISPRSSFLQMDQILAQLKEPQRRRAERRITAFL
LKCQLRALSNQSVEDLSI*

LD06929.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23554-PA 219 GF23554-PA 1..219 1..218 743 71.6 Plus
Dana\GF10162-PA 203 GF10162-PA 4..203 11..218 214 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14393-PA 222 GG14393-PA 1..222 1..218 966 93.2 Plus
Dere\GG15076-PA 198 GG15076-PA 4..198 11..218 206 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22582-PA 257 GH22582-PA 1..257 1..218 577 51.1 Plus
Dgri\GH15369-PA 257 GH15369-PA 1..257 1..218 577 51.1 Plus
Dgri\GH16194-PA 209 GH16194-PA 7..209 11..218 200 28.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG9948-PC 218 CG9948-PC 1..218 1..218 1131 100 Plus
CG9948-PB 218 CG9948-PB 1..218 1..218 1131 100 Plus
CG9948-PA 218 CG9948-PA 1..218 1..218 1131 100 Plus
CG6683-PA 197 CG6683-PA 4..197 11..218 205 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12972-PA 245 GI12972-PA 1..245 1..218 619 54.8 Plus
Dmoj\GI13343-PA 213 GI13343-PA 7..213 11..218 218 28.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15048-PA 168 GL15048-PA 1..59 1..59 279 83.1 Plus
Dper\GL15048-PA 168 GL15048-PA 110..168 160..218 188 62.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22146-PA 244 GA22146-PA 1..244 1..218 662 56.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14808-PA 218 GM14808-PA 1..218 1..218 1139 97.7 Plus
Dsec\GM24933-PA 199 GM24933-PA 4..199 11..218 206 28.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13980-PA 218 GD13980-PA 1..218 1..218 1136 97.7 Plus
Dsim\GD12981-PA 199 GD12981-PA 4..199 11..218 221 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13117-PA 246 GJ13117-PA 1..246 1..218 610 54.6 Plus
Dvir\GJ13172-PA 216 GJ13172-PA 7..216 11..218 185 26.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16989-PA 217 GK16989-PA 1..217 1..218 642 56.7 Plus
Dwil\GK20541-PA 215 GK20541-PA 7..213 11..216 239 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21583-PA 222 GE21583-PA 1..222 1..218 1022 93.7 Plus
Dyak\GE21300-PA 198 GE21300-PA 4..198 11..218 222 30.5 Plus

LD06929.hyp Sequence

Translation from 58 to 714

> LD06929.hyp
MRTSYKKNRPFDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEM
MGCDVDFCLMRWNNLHYQFRKEFRRADTSGSTWPYLERLRFLAEIQPPSK
VKTKPKTNKQEATIQTETPVQFLWDTFEDGDVPQQSSTFIIEEVIEEPSE
QIIQEEIIYEEQEPAEIISPRSSFLQMDQILAQLKEPQRRRAERRITAFL
LKCQLRALSNQSVEDLSI*

LD06929.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG9948-PC 218 CG9948-PC 1..218 1..218 1131 100 Plus
CG9948-PB 218 CG9948-PB 1..218 1..218 1131 100 Plus
CG9948-PA 218 CG9948-PA 1..218 1..218 1131 100 Plus
CG6683-PA 197 CG6683-PA 4..197 11..218 205 28.8 Plus