Clone LD07519 Report

Search the DGRC for LD07519

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:75
Well:19
Vector:pBS SK-
Associated Gene/TranscriptCG42445-RA
Protein status:LD07519.pep: gold
Preliminary Size:1149
Sequenced Size:920

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7498 2001-01-01 Release 2 assignment
CG7498 2003-01-01 Sim4 clustering to Release 3
CG7498 2008-04-29 Release 5.5 accounting
CG7498 2008-08-15 Release 5.9 accounting
CG42445 2008-12-18 5.12 accounting

Clone Sequence Records

LD07519.complete Sequence

920 bp (920 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061086.1

> LD07519.complete
CTACGTCCGTTTGTGTTTTATATTGTTTACTGACCTGATAAGACGATAAT
ACGCCGCAATGGATGAATAATGCGAAAGCCATTTTAGAGGGTCCGAGACA
ACGGCGAAGAAAGGAGAAAGAAAGGCCGACCGCTGTGATAATACCCGATG
CTCCAAAACAAATTAGCATAATCAAGGCGCCTGCCCAATGGCTGACCATT
GAGAGATACATACATCTATTGAGAAAAAAACGCACTTTTGTGCCGCGATC
ATTAACGCGATCAAATGCAAATGAGGCGACATCAGTCAAGCGGCCGAAAG
CGAAATGTGCAGCAGCATCATCAGCTCGATAAGTTTGGACTAGCGATTGC
ATAATAGAGCTAACATCAAACAACAAACGACCTCATTTCGGAAATCGCAA
AACCCCGAACACACCGAAGATAGACCCAAAGTTTTGCATGACGTATACGC
AACGTGGGCCGCAATAATGGATCTAATGGAGCTGCTGCATCAGCTGTTCC
TTCACATACTTGACATTTTTAAGATCTACATCAAGTTTGCACTGATCACG
CTGGTCATCTATTTCCTGGCCGAGTGGTACATACTGCGATATGGAGCAGA
ATTGGAGGCCGAACTGGACGCCCATCTGGTGGAAGGTGCCGAACTCAGGG
AGGAATCCCCCGAGCGACCTGAATCGAATAGCACGCTGAGCAAGGTGTTT
CGCTTCGTGGTGAACTTTTTCATCCTCTAAGCGACTGGATTGAAGCCACT
TGTCAAGGTCAATCGCAAAGCTGAACAGTTGAATCGGTTGCTTTTTCGCG
GAATTGCAATTCAATTCAGGCAGCCACAACTCAAGGCTCCCGTCAAGAGA
ATGTAAAATCGAACCAGTTGCATTTAACAACAGAAAATACAAAACAAAAA
TAAAAAAAAAAAAAAAAAAA

LD07519.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42445-RA 1194 CG42445-RA 192..1109 1..918 4560 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8146763..8147590 901..74 4140 100 Minus
chr3L 24539361 chr3L 8150769..8150842 74..1 370 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8154736..8155580 918..74 4195 99.8 Minus
3L 28110227 3L 8158757..8158830 74..1 370 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8147836..8148680 918..74 4195 99.7 Minus
3L 28103327 3L 8151857..8151930 74..1 370 100 Minus
Blast to na_te.dros performed 2019-03-16 10:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 4568..4661 808..901 135 67 Plus

LD07519.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:15:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8146793..8147589 75..871 100 <- Minus
chr3L 8150769..8150842 1..74 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:39:40 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 1..264 467..730 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:53 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 1..264 467..730 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:38:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 1..264 467..730 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:43 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG7498-RA 1..270 63..332 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:58 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 1..264 467..730 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:23 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 65..965 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:53 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 65..965 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 71..971 1..901 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:43 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG7498-RA 43..916 1..874 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:58 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
CG42445-RA 71..971 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8154753..8155579 75..901 100 <- Minus
3L 8158757..8158830 1..74 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8154753..8155579 75..901 100 <- Minus
3L 8158757..8158830 1..74 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8154753..8155579 75..901 100 <- Minus
3L 8158757..8158830 1..74 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:55 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8151857..8151930 1..74 100   Minus
arm_3L 8147853..8148679 75..901 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:36 Download gff for LD07519.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8151857..8151930 1..74 100   Minus
3L 8147853..8148679 75..901 100 <- Minus

LD07519.hyp Sequence

Translation from 62 to 331

> LD07519.hyp
MNNAKAILEGPRQRRRKEKERPTAVIIPDAPKQISIIKAPAQWLTIERYI
HLLRKKRTFVPRSLTRSNANEATSVKRPKAKCAAASSAR*
Sequence LD07519.hyp has no blast hits.

LD07519.pep Sequence

Translation from 466 to 729

> LD07519.pep
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL*

LD07519.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10478-PA 88 GF10478-PA 1..88 1..87 353 80.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14916-PA 87 GG14916-PA 1..87 1..87 426 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15284-PA 74 GH15284-PA 1..69 1..73 236 64.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42445-PB 87 CG42445-PB 1..87 1..87 438 100 Plus
CG42445-PA 87 CG42445-PA 1..87 1..87 438 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11994-PA 79 GI11994-PA 1..79 1..87 287 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24408-PA 87 GA24408-PA 1..87 1..87 346 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24966-PA 87 GM24966-PA 1..87 1..87 428 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12219-PA 79 GJ12219-PA 1..79 1..87 267 60.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20369-PA 87 GE20369-PA 1..87 1..87 436 98.9 Plus