Clone LD07651 Report

Search the DGRC for LD07651

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:76
Well:51
Vector:pBS SK-
Associated Gene/TranscriptHo-RA
Protein status:LD07651.pep: gold
Preliminary Size:1281
Sequenced Size:1127

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14716 2001-01-01 Release 2 assignment
CG14716 2001-10-10 Blastp of sequenced clone
CG14716 2003-01-01 Sim4 clustering to Release 3
Ho 2008-04-29 Release 5.5 accounting
Ho 2008-08-15 Release 5.9 accounting
Ho 2008-12-18 5.12 accounting

Clone Sequence Records

LD07651.complete Sequence

1127 bp (1127 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061087

> LD07651.complete
TGGAGTTCAAAACAAAACAAAGACGGCGTATTTTGCAAATATCACGTAGA
TAAGGAATATATTTTACTTTGTAATTGGGAACAATAGCTGCGCAAAAGAA
ACATGTCAGCGAGCGAAGAAACAATAGCGGACAGTCAGGTCTCCGAGAAT
GTGGAGGATGTGGAATTCGTAGACATGGCGTTCACAAAGGAGTTGCGTAA
AGCCACAAAAGATGTGCATAATCTTACTGATGTTCTAGTGAATGCAAAGA
TCGCACTTGCCCTTTCTGATGACGAGGTCTGGTATGATGGACTCCTGGCC
TTCTACGAACTGTACAAATTCTTTGAGACCCATCTGCCGGAGCGCCTGCT
GCCCAAAGAATTCCACAGAACAGCGGCATTTGAAAGGGATTTTGCCTATT
TCTACGGTTCCGATTGGAGGAAGGACTACGAAATTCGCCCGGCGGTCCAG
AAATATCTCGAGCATCTGGAAAAGATTGCCGCACAGAACGAACTCTTGCT
GTTCGCCTACTCCTATCAGATGTACATGGCTTTGATGTCCGGCGGACAAA
TGTTGCAGAAGAAGCGTATGATCGCTCGTAAAATGTGGATCTTTTCAAAG
AACGATGACGAGGAGCAGCAGAAGCAGGCCGACAAGGAGGCAGAGTTGGC
CACCGCCAGAGCTGCCGATGGCTCTGTAGACAAAGACGACTTGGAGGCCA
GGCCAATGCCTGCCCAGGTTACCATTTGCCCGCCGGGATGTGAGGCCACA
TATTTTCCTGAGAAGATCTCTGTCTTAAAGGCCAAACTAAGGCGCGTTTT
CAACAATCACTACGGAGCTTTTGACGATGATTTGCGTGCTGCTTTTATTG
AGGAAAGTCGCAACGTATTTCGCTTAAATATAGAAGTAGTACGGACCATC
AAAGGCGTGAATCGTGCCAATCTTAGGAAGCTGGCCCTCGCACTAATCTT
TGTTTCAAGTATTGTAGTGGCCGTGAAATTTGCTCTCAAGTAAGAAAAGT
AGGAAATACAAATGTAAGCTCTCTTGAGCAAGTTAGAATTGTGATCACAC
ATTTATTTAGTCGTTTGTTAAATAGTAAATAACCTGAAATTTGTCTGAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

LD07651.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Ho-RA 1175 Ho-RA 42..1140 1..1099 5480 99.9 Plus
CG6830-RA 2902 CG6830-RA 2849..2902 1099..1046 270 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7505616..7506122 259..765 2535 100 Plus
chr3R 27901430 chr3R 7506176..7506509 764..1097 1655 99.7 Plus
chr3R 27901430 chr3R 7505302..7505560 1..259 1280 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11680083..11680589 259..765 2535 100 Plus
3R 32079331 3R 11680643..11680978 764..1099 1665 99.7 Plus
3R 32079331 3R 11679769..11680027 1..259 1295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11420914..11421420 259..765 2535 100 Plus
3R 31820162 3R 11421474..11421809 764..1099 1665 99.7 Plus
3R 31820162 3R 11420600..11420858 1..259 1295 100 Plus
Blast to na_te.dros performed 2019-03-16 04:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
R1-2 3216 R1-2 R1-2 3216bp 3069..3122 254..308 110 69.1 Plus

LD07651.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:03:26 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7505302..7505560 1..259 99 -> Plus
chr3R 7505617..7506122 260..765 100 -> Plus
chr3R 7506178..7506509 766..1097 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:01 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 1..891 103..993 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:22 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 1..891 103..993 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:52 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 1..891 103..993 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:17:05 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 1..891 103..993 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:10 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 1..891 103..993 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:21 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 11..1107 1..1097 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:22 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 11..1107 1..1097 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:52 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 27..1123 1..1097 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:17:05 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 11..1107 1..1097 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:10 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
Ho-RA 27..1123 1..1097 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:26 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11679769..11680027 1..259 100 -> Plus
3R 11680645..11680976 766..1097 99   Plus
3R 11680084..11680589 260..765 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:26 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11679769..11680027 1..259 100 -> Plus
3R 11680645..11680976 766..1097 99   Plus
3R 11680084..11680589 260..765 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:26 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11679769..11680027 1..259 100 -> Plus
3R 11680645..11680976 766..1097 99   Plus
3R 11680084..11680589 260..765 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:52 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7505491..7505749 1..259 100 -> Plus
arm_3R 7505806..7506311 260..765 100 -> Plus
arm_3R 7506367..7506698 766..1097 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:54:01 Download gff for LD07651.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11420600..11420858 1..259 100 -> Plus
3R 11420915..11421420 260..765 100 -> Plus
3R 11421476..11421807 766..1097 99   Plus

LD07651.pep Sequence

Translation from 102 to 992

> LD07651.pep
MSASEETIADSQVSENVEDVEFVDMAFTKELRKATKDVHNLTDVLVNAKI
ALALSDDEVWYDGLLAFYELYKFFETHLPERLLPKEFHRTAAFERDFAYF
YGSDWRKDYEIRPAVQKYLEHLEKIAAQNELLLFAYSYQMYMALMSGGQM
LQKKRMIARKMWIFSKNDDEEQQKQADKEAELATARAADGSVDKDDLEAR
PMPAQVTICPPGCEATYFPEKISVLKAKLRRVFNNHYGAFDDDLRAAFIE
ESRNVFRLNIEVVRTIKGVNRANLRKLALALIFVSSIVVAVKFALK*

LD07651.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18390-PA 292 GF18390-PA 3..292 7..296 1271 80.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18355-PA 296 GG18355-PA 1..296 1..296 1523 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18266-PA 306 GH18266-PA 1..306 1..296 1053 68.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ho-PA 296 CG14716-PA 1..296 1..296 1507 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24074-PA 309 GI24074-PA 21..309 14..296 965 64.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12384-PA 296 GL12384-PA 1..296 1..296 1269 79.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13198-PA 296 GA13198-PA 1..296 1..296 1270 79.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23969-PA 296 GM23969-PA 1..296 1..296 1558 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18775-PA 296 GD18775-PA 1..296 1..296 1554 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10893-PA 307 GJ10893-PA 1..307 1..296 1021 64.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11097-PA 298 GK11097-PA 13..298 16..296 1140 74.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24194-PA 296 GE24194-PA 1..296 1..296 1509 95.6 Plus

LD07651.hyp Sequence

Translation from 102 to 992

> LD07651.hyp
MSASEETIADSQVSENVEDVEFVDMAFTKELRKATKDVHNLTDVLVNAKI
ALALSDDEVWYDGLLAFYELYKFFETHLPERLLPKEFHRTAAFERDFAYF
YGSDWRKDYEIRPAVQKYLEHLEKIAAQNELLLFAYSYQMYMALMSGGQM
LQKKRMIARKMWIFSKNDDEEQQKQADKEAELATARAADGSVDKDDLEAR
PMPAQVTICPPGCEATYFPEKISVLKAKLRRVFNNHYGAFDDDLRAAFIE
ESRNVFRLNIEVVRTIKGVNRANLRKLALALIFVSSIVVAVKFALK*

LD07651.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Ho-PA 296 CG14716-PA 1..296 1..296 1507 100 Plus