Clone LD07673 Report

Search the DGRC for LD07673

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:76
Well:73
Vector:pBS SK-
Associated Gene/TranscriptCG1890-RA
Protein status:LD07673.pep: gold
Preliminary Size:938
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1890 2001-01-01 Release 2 assignment
CG1890 2001-10-10 Blastp of sequenced clone
CG1890 2003-01-01 Sim4 clustering to Release 3
CG1890 2008-04-29 Release 5.5 accounting
CG1890 2008-08-15 Release 5.9 accounting
CG1890 2008-12-18 5.12 accounting

Clone Sequence Records

LD07673.complete Sequence

705 bp (705 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061088

> LD07673.complete
TCCGAATCTCAGCCGGCTGTTCGAAGTTTAGTCGAATTAACTGTGATTCA
TGCCAGGAAGTCCCCGTCGAGCTTCACTAACTTCAGTTCATAGGCGAACG
CAGTAGAACGCAGCCCAACAAAAATGACAGACCCCCGCATCCGGCAACTG
GTGATTAAATCCGGAGTGGTCCGGCGGTTGACCAGGGAGAAGTACTGCTA
CGCCAAGGAAGTGCTGACCGAGCAGGCGCGGTTGGAGAAGCTCAGGGGCG
ACGGAGCCGACGACCACGTACTGCGCAAGCAGGAGGAGGTCATCCAGGAG
TGCATCATGATGGTGCCCGACTCCAAGAGAAGACTGCAGAAGGAGTACGA
GGTACTGGAAAAGTACCTCGCCGATGAGCAGGACCTGATCGAGACAGATT
CGTATAAGAAGGCAGCAGAGATCCTCAAAGATGCCAAAGCTGAACTGGAG
ACCTAGAACCACCCCAAAACTTAATTCACTGCCCCTAATGTCAGCATTAA
TGCAAATTCCTGATGGCAATTCCATCTCCGAGCTCTGAGCTGCAGAGCGG
CTTGAATCCACACATACTGAGCTAATACTCTTCCCCTTTGTTTGTTTTAA
AAAAATAACATTATATTTTTTTGAAAAGGAATCGCCTAGTTGCTGGTGGC
GTTCGCCTCACTTTTGCTAAATAAAAATAATAATCTATAAAAAAAAAAAA
AAAAA

LD07673.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1890-RA 814 CG1890-RA 107..796 1..690 3450 100 Plus
CG1890.a 742 CG1890.a 42..724 1..690 3320 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27566242..27566599 331..688 1790 100 Plus
chr3R 27901430 chr3R 27565857..27566188 1..332 1660 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:53:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31743891..31744250 331..690 1800 100 Plus
3R 32079331 3R 31743506..31743837 1..332 1660 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31484722..31485081 331..690 1800 100 Plus
3R 31820162 3R 31484337..31484668 1..332 1660 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:08:15 has no hits.

LD07673.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:09:15 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27565857..27566188 1..332 100 -> Plus
chr3R 27566244..27566576 333..665 91 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:04 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..333 124..456 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:33 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..333 124..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:42 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..333 124..456 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:23:00 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..333 124..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:01 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..333 124..456 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:03:02 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..688 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:33 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..688 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:42 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 17..704 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:23:01 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 1..688 1..688 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:01 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
CG1890-RA 17..704 1..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:15 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31743506..31743837 1..332 100 -> Plus
3R 31743893..31744248 333..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:15 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31743506..31743837 1..332 100 -> Plus
3R 31743893..31744248 333..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:15 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31743506..31743837 1..332 100 -> Plus
3R 31743893..31744248 333..688 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:42 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27569228..27569559 1..332 100 -> Plus
arm_3R 27569615..27569970 333..688 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:33 Download gff for LD07673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31484337..31484668 1..332 100 -> Plus
3R 31484724..31485079 333..688 100   Plus

LD07673.pep Sequence

Translation from 123 to 455

> LD07673.pep
MTDPRIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVL
RKQEEVIQECIMMVPDSKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEI
LKDAKAELET*

LD07673.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23254-PA 110 GF23254-PA 1..108 1..108 377 67.6 Plus
Dana\GF21056-PA 149 GF21056-PA 34..147 1..110 138 28.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11828-PA 110 GG11828-PA 1..110 1..110 516 92.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18653-PA 110 GH18653-PA 1..110 1..110 394 70 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG1890-PA 110 CG1890-PA 1..110 1..110 550 100 Plus
CG9072-PA 149 CG9072-PA 35..146 2..109 140 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23130-PA 110 GI23130-PA 1..106 1..106 387 70.8 Plus
Dmoj\GI21556-PA 134 GI21556-PA 23..131 3..109 156 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23997-PA 49 GL23997-PA 1..47 62..108 166 72.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15111-PA 110 GA15111-PA 1..108 1..108 396 73.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16448-PA 110 GM16448-PA 1..110 1..110 541 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21600-PA 110 GD21600-PA 1..110 1..110 549 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23104-PA 110 GJ23104-PA 1..110 1..110 390 68.2 Plus
Dvir\GJ15700-PA 134 GJ15700-PA 23..131 3..109 158 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12117-PA 110 GK12117-PA 1..108 1..108 409 73.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10962-PA 110 GE10962-PA 1..110 1..110 517 92.7 Plus

LD07673.hyp Sequence

Translation from 123 to 455

> LD07673.hyp
MTDPRIRQLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVL
RKQEEVIQECIMMVPDSKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEI
LKDAKAELET*

LD07673.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG1890-PA 110 CG1890-PA 1..110 1..110 550 100 Plus
CG9072-PA 149 CG9072-PA 35..146 2..109 140 29.5 Plus