Clone LD07728 Report

Search the DGRC for LD07728

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:77
Well:28
Vector:pBS SK-
Associated Gene/TranscriptCG6683-RA
Protein status:LD07728.pep: gold
Preliminary Size:1188
Sequenced Size:979

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6683 2001-01-01 Release 2 assignment
CG6683 2001-10-10 Blastp of sequenced clone
CG6683 2003-01-01 Sim4 clustering to Release 3
CG6683 2008-04-29 Release 5.5 accounting
CG6683 2008-08-15 Release 5.9 accounting
CG6683 2008-12-18 5.12 accounting

Clone Sequence Records

LD07728.complete Sequence

979 bp assembled on 2007-04-17

GenBank Submission: AY061089

> LD07728.complete
ATTTGTTTACATATTTTCATTTGTGTTTATTTTGAAAATATCAAAATGTC
GCAGTTCGACACGCGACTTATTGAGCTGGTTAGGGCTAATCCCAAGCTTT
ATGAGCGCGAACTTAGAAACGCACCCTACGAAGCGCATAAGAAGCGACAT
CCGGAAATCTGGAGCAGCATCGCCACTTCATTAAATTCAGAAGCTAGTGC
CTGTGTCAGTCGTTGGAATCATCTGGTGGCCAAACAGCGTCGGGAGCTGG
CCAAAGAAAAGGCCGGAGGCACTGGCTCCGATTGGAGTCTTCTGCCGCAT
TTGAAATTCCTGCAGCATCACCACCATCCGATTAATCACCGAAATTCGGG
TGATCTGAGTAGGAGCACACTGAAATCCAGCGACGAGGTCAACGATGATG
AGGATCCGCTCCAGGAGGCCATGGATGAGCAGCTGGCCGTTGCGGGAGCT
GCACCAGCACCACCCACAAATCCTGCCCATGCAACGCCAGTGGCTCAAGC
AGAAAAGAGGATAGAAGCCCTGCTTGAAGGACTGGGCGAAGCAAACCGAA
TTAAGGCGGAGAAACGCATTCTGGCCTACCTATGCAAATGCAATCTGCGC
GCCCTGAACGACGAGCAAATCGATGATATAGTTATTTAGGAAGATTGCCA
AGATGATATAGTTATAAAGGAAGATTGCCATGATGATAAGTTAAATACAT
ACATGCCGTGATAGGATATCAAAAGTAGCAAACATCACTGATCATATAAT
TGTTTAATAATTAAGTCATTTTTGTTATAGTTTATATATCTGGACAATTA
TCTTAAGCGAATACTAAATAACTTCTTTTTCCAAATGTATGCTTCCCTAA
AAAATATTGTTAATCCATTCATTTAACCTAATCTTCGCATCTAATGAAGT
TTACTATACAAACTAACTATTGCATTGTATGATATGATAAAACATTAACA
CGCCTGTGATTAAAAAAAAAAAAAAAAAA

LD07728.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6683-RA 1110 CG6683-RA 94..1057 1..964 4820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8505837..8506606 961..192 3775 99.4 Minus
chr3L 24539361 chr3L 8506665..8506855 191..1 955 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8513871..8514643 964..192 3865 100 Minus
3L 28110227 3L 8514700..8514892 193..1 965 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8506971..8507743 964..192 3865 100 Minus
3L 28103327 3L 8507800..8507992 193..1 965 100 Minus
Blast to na_te.dros performed 2019-03-16 21:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 3738..3811 749..821 115 63.5 Plus
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 801..840 1..41 112 78 Plus

LD07728.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:38:06 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8505837..8506604 194..961 99 <- Minus
chr3L 8506663..8506855 1..193 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:15 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..594 46..639 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:19:15 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..594 46..639 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:47 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..594 46..639 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:15:46 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..594 46..639 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:23 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..594 46..639 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:34:57 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..960 2..961 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:19:15 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..960 2..961 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:47 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 30..990 1..961 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:15:46 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 1..960 2..961 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:23 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
CG6683-RA 30..990 1..961 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:06 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8513874..8514641 194..961 100 <- Minus
3L 8514700..8514892 1..193 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:06 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8513874..8514641 194..961 100 <- Minus
3L 8514700..8514892 1..193 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:06 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8513874..8514641 194..961 100 <- Minus
3L 8514700..8514892 1..193 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:47 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8506974..8507741 194..961 100 <- Minus
arm_3L 8507800..8507992 1..193 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:08:09 Download gff for LD07728.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8506974..8507741 194..961 100 <- Minus
3L 8507800..8507992 1..193 100   Minus

LD07728.hyp Sequence

Translation from 0 to 638

> LD07728.hyp
ICLHIFICVYFENIKMSQFDTRLIELVRANPKLYERELRNAPYEAHKKRH
PEIWSSIATSLNSEASACVSRWNHLVAKQRRELAKEKAGGTGSDWSLLPH
LKFLQHHHHPINHRNSGDLSRSTLKSSDEVNDDEDPLQEAMDEQLAVAGA
APAPPTNPAHATPVAQAEKRIEALLEGLGEANRIKAEKRILAYLCKCNLR
ALNDEQIDDIVI*

LD07728.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6683-PA 197 CG6683-PA 1..197 16..212 1027 100 Plus
CG9948-PC 218 CG9948-PC 7..218 15..212 206 28.7 Plus
CG9948-PB 218 CG9948-PB 7..218 15..212 206 28.7 Plus
CG9948-PA 218 CG9948-PA 7..218 15..212 206 28.7 Plus

LD07728.pep Sequence

Translation from 45 to 638

> LD07728.pep
MSQFDTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEA
SACVSRWNHLVAKQRRELAKEKAGGTGSDWSLLPHLKFLQHHHHPINHRN
SGDLSRSTLKSSDEVNDDEDPLQEAMDEQLAVAGAAPAPPTNPAHATPVA
QAEKRIEALLEGLGEANRIKAEKRILAYLCKCNLRALNDEQIDDIVI*

LD07728.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10162-PA 203 GF10162-PA 1..203 1..197 578 62.6 Plus
Dana\GF23554-PA 219 GF23554-PA 11..219 4..197 198 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15076-PA 198 GG15076-PA 1..198 1..197 837 86.4 Plus
Dere\GG14393-PA 222 GG14393-PA 11..222 4..197 196 29.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16194-PA 209 GH16194-PA 6..209 3..197 460 50.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6683-PA 197 CG6683-PA 1..197 1..197 1027 100 Plus
CG9948-PC 218 CG9948-PC 11..218 4..197 205 28.8 Plus
CG9948-PB 218 CG9948-PB 11..218 4..197 205 28.8 Plus
CG9948-PA 218 CG9948-PA 11..218 4..197 205 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13343-PA 213 GI13343-PA 5..213 2..197 477 51.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15568-PA 196 GL15568-PA 1..196 1..197 363 41.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Ovd-PA 196 GA19777-PA 1..196 1..197 366 41.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24933-PA 199 GM24933-PA 1..199 1..197 948 92 Plus
Dsec\GM14808-PA 218 GM14808-PA 11..218 4..197 208 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12981-PA 199 GD12981-PA 1..199 1..197 898 95 Plus
Dsim\GD13980-PA 218 GD13980-PA 11..218 4..197 197 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13172-PA 216 GJ13172-PA 5..216 2..197 462 54.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20541-PA 215 GK20541-PA 7..215 4..197 487 50.2 Plus
Dwil\GK16989-PA 217 GK16989-PA 11..217 4..197 217 29.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21300-PA 198 GE21300-PA 1..198 1..197 913 88.9 Plus
Dyak\GE21583-PA 222 GE21583-PA 11..222 4..197 213 30.3 Plus