Clone LD07740 Report

Search the DGRC for LD07740

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:77
Well:40
Vector:pBS SK-
Associated Gene/TranscriptMED9-RC
Protein status:LD07740.pep: gold
Preliminary Size:1081
Sequenced Size:871

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5134 2001-01-01 Release 2 assignment
CG5134 2002-06-13 Blastp of sequenced clone
CG5134 2003-01-01 Sim4 clustering to Release 3
MED9 2008-04-29 Release 5.5 accounting
MED9 2008-08-15 Release 5.9 accounting
MED9 2008-12-18 5.12 accounting

Clone Sequence Records

LD07740.complete Sequence

871 bp (871 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122154

> LD07740.complete
TGATTCTGACGCTGGAAATTCGATTCGTGTTTTTTATGATGGATTTGTCG
CCAAACAATCAGATCGAGGACAGAAAACCCATCCTAACCGCCGACGGCCT
GGTTCAGACTTCGAACTCCCCCTTCGAGCCGACCATATCGCAGGAGACGC
AAACATCCAACGGAATCGGCGGCCAGTGCCATCTGACGGTTGACCAGTTG
GACATTGAGATTCTGCCGATAATCTACGACATTGTGCGCTGCGTGGAAAA
GGATCCTCTGGAGAACGCCGTTAAGCTGCGCGAGTCCCAGGATTGCAACC
ACAAGATCTTTGAACTTCAAAAACGCTTCGAATCGGCACGCGAGCAAATC
CGCCAGCTCCCCGGGATCGATTTCAATAAGGAGGAGCAGCAACAGAGACT
GGAACTACTGCGAAATCAGCTGAAGCTTAAGCAGCAGCTAATTCGCAAAT
ACAAGGACACAGAGTTCTAGGCGGCAGCAAAATAAAAAAAAGGGCAAGAT
GGTGCTGCGACTGCTAATGCGCTACCTGGCCAACAACGAGCAGCTCATCC
AGCGCATGGCGGAGAGCTATCCCATGAGACGCGCTGCCCAGTTGGTCGTT
TCCCTGATGTACCGCACAAAAGACTTGGCCCGGGAGCAGGGACTGCACGA
GATGACGCCAGAGCGTTTCAAATCCTTCGTTAACATGTTTAAGAACAACG
TGCGCCAAGAGCTGGAGGGAGTGAAGAAGGAGCTTAATAGCAAGAAAAAG
AACTAGGGTTCAGTAATTAACTTGTTTAACTACAATTGTATATACGCGGC
AAGATAAATTTTAGTAAACACAGATGAATAAACATTGAAGCCAGGAAAAA
AAAAAAAAAAAAAAAAAAAAA

LD07740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-RA 844 CG42518-RA 1..844 1..844 4220 100 Plus
MED9-RC 849 MED9-RC 6..849 1..844 4220 100 Plus
CG42518-RB 825 CG42518-RB 43..825 62..844 3915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14054920..14055287 304..671 1840 100 Plus
chr2R 21145070 chr2R 14054431..14054671 1..241 1205 100 Plus
chr2R 21145070 chr2R 14055357..14055529 672..844 820 98.3 Plus
chr2R 21145070 chr2R 14054806..14054870 241..305 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18167771..18168138 304..671 1840 100 Plus
2R 25286936 2R 18167282..18167522 1..241 1205 100 Plus
2R 25286936 2R 18168208..18168380 672..844 865 100 Plus
2R 25286936 2R 18167657..18167721 241..305 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18168970..18169337 304..671 1840 100 Plus
2R 25260384 2R 18168481..18168721 1..241 1205 100 Plus
2R 25260384 2R 18169407..18169579 672..844 865 100 Plus
2R 25260384 2R 18168856..18168920 241..305 325 100 Plus
Blast to na_te.dros performed 2019-03-15 22:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6907 374..492 121 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2432 385..491 120 61.8 Plus
roo 9092 roo DM_ROO 9092bp 1128..1210 385..469 114 61.2 Plus
roo 9092 roo DM_ROO 9092bp 1089..1150 379..440 112 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6810..6865 382..437 109 66.1 Plus

LD07740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:15:33 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14054431..14054671 1..241 100 -> Plus
chr2R 14054807..14054870 242..305 100 -> Plus
chr2R 14054922..14055287 306..671 100 -> Plus
chr2R 14055357..14055529 672..845 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:18 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 1..435 36..470 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:36 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 1..435 36..470 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:12:11 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 1..435 36..470 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:26 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 1..435 36..470 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:16 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 1..435 36..470 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:47:49 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 6..849 1..844 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:36 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 6..849 1..844 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:12:11 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 28..871 1..844 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:26 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 6..849 1..844 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:16 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
CG42518-RA 28..871 1..844 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:33 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167282..18167522 1..241 100 -> Plus
2R 18167658..18167721 242..305 100 -> Plus
2R 18167773..18168138 306..671 100 -> Plus
2R 18168208..18168380 672..845 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:33 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167282..18167522 1..241 100 -> Plus
2R 18167658..18167721 242..305 100 -> Plus
2R 18167773..18168138 306..671 100 -> Plus
2R 18168208..18168380 672..845 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:33 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167282..18167522 1..241 100 -> Plus
2R 18167658..18167721 242..305 100 -> Plus
2R 18167773..18168138 306..671 100 -> Plus
2R 18168208..18168380 672..845 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:12:11 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14054787..14055027 1..241 100 -> Plus
arm_2R 14055163..14055226 242..305 100 -> Plus
arm_2R 14055278..14055643 306..671 100 -> Plus
arm_2R 14055713..14055885 672..845 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:06 Download gff for LD07740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18168481..18168721 1..241 100 -> Plus
2R 18168857..18168920 242..305 100 -> Plus
2R 18168972..18169337 306..671 100 -> Plus
2R 18169407..18169579 672..845 99   Plus

LD07740.hyp Sequence

Translation from 2 to 469

> LD07740.hyp
ILTLEIRFVFFMMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQ
TSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNH
KIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKY
KDTEF*

LD07740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
MED9-PC 144 CG42517-PC 1..144 12..155 740 100 Plus

LD07740.pep Sequence

Translation from 35 to 469

> LD07740.pep
MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHL
TVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFES
AREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF*

LD07740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12138-PA 145 GF12138-PA 1..145 1..144 697 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21850-PA 230 GG21850-PA 1..145 1..144 737 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20126-PA 161 GH20126-PA 1..161 2..144 608 81.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
MED9-PC 144 CG42517-PC 1..144 1..144 740 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20216-PA 142 GI20216-PA 1..142 2..144 645 90.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11612-PA 143 GL11612-PA 1..143 2..144 707 95.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18683-PA 143 GA18683-PA 1..143 2..144 703 94.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21852-PA 229 GM21852-PA 1..144 1..144 758 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15439-PA 229 GD15439-PA 1..144 1..144 758 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20165-PA 170 GJ20165-PA 1..170 2..144 619 76.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10692-PA 158 GK10692-PA 1..158 2..144 598 83.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11929-PA 144 GE11929-PA 1..144 2..144 721 98.6 Plus