BDGP Sequence Production Resources |
Search the DGRC for LD07740
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 77 |
Well: | 40 |
Vector: | pBS SK- |
Associated Gene/Transcript | MED9-RC |
Protein status: | LD07740.pep: gold |
Preliminary Size: | 1081 |
Sequenced Size: | 871 |
Gene | Date | Evidence |
---|---|---|
CG5134 | 2001-01-01 | Release 2 assignment |
CG5134 | 2002-06-13 | Blastp of sequenced clone |
CG5134 | 2003-01-01 | Sim4 clustering to Release 3 |
MED9 | 2008-04-29 | Release 5.5 accounting |
MED9 | 2008-08-15 | Release 5.9 accounting |
MED9 | 2008-12-18 | 5.12 accounting |
871 bp (871 high quality bases) assembled on 2002-06-13
GenBank Submission: AY122154
> LD07740.complete TGATTCTGACGCTGGAAATTCGATTCGTGTTTTTTATGATGGATTTGTCG CCAAACAATCAGATCGAGGACAGAAAACCCATCCTAACCGCCGACGGCCT GGTTCAGACTTCGAACTCCCCCTTCGAGCCGACCATATCGCAGGAGACGC AAACATCCAACGGAATCGGCGGCCAGTGCCATCTGACGGTTGACCAGTTG GACATTGAGATTCTGCCGATAATCTACGACATTGTGCGCTGCGTGGAAAA GGATCCTCTGGAGAACGCCGTTAAGCTGCGCGAGTCCCAGGATTGCAACC ACAAGATCTTTGAACTTCAAAAACGCTTCGAATCGGCACGCGAGCAAATC CGCCAGCTCCCCGGGATCGATTTCAATAAGGAGGAGCAGCAACAGAGACT GGAACTACTGCGAAATCAGCTGAAGCTTAAGCAGCAGCTAATTCGCAAAT ACAAGGACACAGAGTTCTAGGCGGCAGCAAAATAAAAAAAAGGGCAAGAT GGTGCTGCGACTGCTAATGCGCTACCTGGCCAACAACGAGCAGCTCATCC AGCGCATGGCGGAGAGCTATCCCATGAGACGCGCTGCCCAGTTGGTCGTT TCCCTGATGTACCGCACAAAAGACTTGGCCCGGGAGCAGGGACTGCACGA GATGACGCCAGAGCGTTTCAAATCCTTCGTTAACATGTTTAAGAACAACG TGCGCCAAGAGCTGGAGGGAGTGAAGAAGGAGCTTAATAGCAAGAAAAAG AACTAGGGTTCAGTAATTAACTTGTTTAACTACAATTGTATATACGCGGC AAGATAAATTTTAGTAAACACAGATGAATAAACATTGAAGCCAGGAAAAA AAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14054920..14055287 | 304..671 | 1840 | 100 | Plus |
chr2R | 21145070 | chr2R | 14054431..14054671 | 1..241 | 1205 | 100 | Plus |
chr2R | 21145070 | chr2R | 14055357..14055529 | 672..844 | 820 | 98.3 | Plus |
chr2R | 21145070 | chr2R | 14054806..14054870 | 241..305 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18167771..18168138 | 304..671 | 1840 | 100 | Plus |
2R | 25286936 | 2R | 18167282..18167522 | 1..241 | 1205 | 100 | Plus |
2R | 25286936 | 2R | 18168208..18168380 | 672..844 | 865 | 100 | Plus |
2R | 25286936 | 2R | 18167657..18167721 | 241..305 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18168970..18169337 | 304..671 | 1840 | 100 | Plus |
2R | 25260384 | 2R | 18168481..18168721 | 1..241 | 1205 | 100 | Plus |
2R | 25260384 | 2R | 18169407..18169579 | 672..844 | 865 | 100 | Plus |
2R | 25260384 | 2R | 18168856..18168920 | 241..305 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6791..6907 | 374..492 | 121 | 59.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2326..2432 | 385..491 | 120 | 61.8 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1128..1210 | 385..469 | 114 | 61.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1089..1150 | 379..440 | 112 | 64.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6810..6865 | 382..437 | 109 | 66.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14054431..14054671 | 1..241 | 100 | -> | Plus |
chr2R | 14054807..14054870 | 242..305 | 100 | -> | Plus |
chr2R | 14054922..14055287 | 306..671 | 100 | -> | Plus |
chr2R | 14055357..14055529 | 672..845 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 1..435 | 36..470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 1..435 | 36..470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 1..435 | 36..470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 1..435 | 36..470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 1..435 | 36..470 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 6..849 | 1..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 6..849 | 1..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 28..871 | 1..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
MED9-RC | 6..849 | 1..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42518-RA | 28..871 | 1..844 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18167282..18167522 | 1..241 | 100 | -> | Plus |
2R | 18167658..18167721 | 242..305 | 100 | -> | Plus |
2R | 18167773..18168138 | 306..671 | 100 | -> | Plus |
2R | 18168208..18168380 | 672..845 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18167282..18167522 | 1..241 | 100 | -> | Plus |
2R | 18167658..18167721 | 242..305 | 100 | -> | Plus |
2R | 18167773..18168138 | 306..671 | 100 | -> | Plus |
2R | 18168208..18168380 | 672..845 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18167282..18167522 | 1..241 | 100 | -> | Plus |
2R | 18167658..18167721 | 242..305 | 100 | -> | Plus |
2R | 18167773..18168138 | 306..671 | 100 | -> | Plus |
2R | 18168208..18168380 | 672..845 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14054787..14055027 | 1..241 | 100 | -> | Plus |
arm_2R | 14055163..14055226 | 242..305 | 100 | -> | Plus |
arm_2R | 14055278..14055643 | 306..671 | 100 | -> | Plus |
arm_2R | 14055713..14055885 | 672..845 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18168481..18168721 | 1..241 | 100 | -> | Plus |
2R | 18168857..18168920 | 242..305 | 100 | -> | Plus |
2R | 18168972..18169337 | 306..671 | 100 | -> | Plus |
2R | 18169407..18169579 | 672..845 | 99 | Plus |
Translation from 2 to 469
> LD07740.hyp ILTLEIRFVFFMMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQ TSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNH KIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKY KDTEF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
MED9-PC | 144 | CG42517-PC | 1..144 | 12..155 | 740 | 100 | Plus |
Translation from 35 to 469
> LD07740.pep MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHL TVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFES AREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12138-PA | 145 | GF12138-PA | 1..145 | 1..144 | 697 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21850-PA | 230 | GG21850-PA | 1..145 | 1..144 | 737 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20126-PA | 161 | GH20126-PA | 1..161 | 2..144 | 608 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
MED9-PC | 144 | CG42517-PC | 1..144 | 1..144 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20216-PA | 142 | GI20216-PA | 1..142 | 2..144 | 645 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11612-PA | 143 | GL11612-PA | 1..143 | 2..144 | 707 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18683-PA | 143 | GA18683-PA | 1..143 | 2..144 | 703 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21852-PA | 229 | GM21852-PA | 1..144 | 1..144 | 758 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15439-PA | 229 | GD15439-PA | 1..144 | 1..144 | 758 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20165-PA | 170 | GJ20165-PA | 1..170 | 2..144 | 619 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10692-PA | 158 | GK10692-PA | 1..158 | 2..144 | 598 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11929-PA | 144 | GE11929-PA | 1..144 | 2..144 | 721 | 98.6 | Plus |