Clone LD07760 Report

Search the DGRC for LD07760

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:77
Well:60
Vector:pBS SK-
Associated Gene/TranscriptSelR-RB
Protein status:LD07760.pep: gold
Sequenced Size:961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6584 2004-01-14 Blastp of sequenced clone
SelR 2008-04-29 Release 5.5 accounting
SelR 2008-08-15 Release 5.9 accounting
SelR 2008-12-18 5.12 accounting

Clone Sequence Records

LD07760.complete Sequence

961 bp (961 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011487

> LD07760.complete
CGCTGCGTAACATTGCGACGCACGCTTGTTTTCGCCCGCGTTTGGCGCAT
TCATAAACAAAAGGCCAAAAATAGAATCAGCACCATTTAGAGCGCTATTC
AGCAGATTCACGCCAAGACAGCGACAATCCGGACAAAAGGTATTCCGGAC
CAGCAGCGACTATGGATAACAAGAGCGAGAAGGTTACGGTGAACAAGGAG
GAGCTGCGCAAGCGCCTGACCCCGGTGCAGTATCAGGTTACCCAGGAGGC
GGGCACCGAGCGACCCTTCACAGGTTGCTACAACAAACACTACGAGAAGG
GCGTGTACCAGTGCATCGTGTGCCACCAGGATCTGTTCAGCTCGGAGACC
AAGTACGACTCGGGATGCGGATGGCCGGCCTTCAACGATGTCCTAGACAA
GGGCAAGGTCACGCTGCACCGCGATGCCAGCATACCAGGGGGCAATATTT
TACTACTAATCGCACATCCAGAACGTATACGCACTGAGGTCCGCTGCGCC
CGCTGCAACGCCCACATGGGTCACGTCTTCGAGGATGGTCCGAAGCCGAC
CCGCAAGCGCTACTGCATCAATTCCGCCTCCATTGAGTTCGTGAACGCGG
ATCCCGCCACCTCGTCCCCGCCCGTGGCCACGCCCACCGCGGCGCCCATT
GCCCAGCAGTGATGCCGAGGATCAACCGCCAAACGGAGGAGGCAAGCCTC
AGAGTGTCGTTGCTGTTAAGAAATTTTTCTACGTGTACTTTCTAACTTTC
CGCAAATGTGGCCAATTTTAGCTCGTAGTCAAGTCAATCGCCCCTCTGTT
TGTGTAAATAGCTAATGTTTTGGTTCGAAATTTGTTCGTTAATTTATACA
AACCCAAATACCGAATACTCTGTAACCCCACACATTCAACACAGTACTAA
TTTTAAAGTGAGCGCGCTAAATAAACGTGTGTTTTTTACAATAAAAAAAA
AAAAAAAAAAA

LD07760.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
SelR-RB 1208 SelR-RB 133..1078 1..946 4730 100 Plus
SelR.b 1531 SelR.b 560..1404 102..946 4225 100 Plus
SelR.a 955 SelR.a 475..953 468..946 2395 100 Plus
SelR.a 955 SelR.a 143..478 103..438 1680 100 Plus
SelR.b 1531 SelR.b 93..197 1..105 525 100 Plus
SelR.a 955 SelR.a 23..127 1..105 525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6688893..6689398 942..437 2530 100 Minus
chr3R 27901430 chr3R 6692344..6692516 275..103 865 100 Minus
chr3R 27901430 chr3R 6692065..6692235 439..269 855 100 Minus
chr3R 27901430 chr3R 6693976..6694080 105..1 525 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10863351..10863860 946..437 2550 100 Minus
3R 32079331 3R 10866807..10866979 275..103 865 100 Minus
3R 32079331 3R 10866528..10866698 439..269 855 100 Minus
3R 32079331 3R 10868439..10868543 105..1 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10604182..10604691 946..437 2550 100 Minus
3R 31820162 3R 10607638..10607810 275..103 865 100 Minus
3R 31820162 3R 10607359..10607529 439..269 855 100 Minus
3R 31820162 3R 10609270..10609374 105..1 525 100 Minus
3R 31820162 3R 10606387..10606449 542..480 165 84.1 Minus
Blast to na_te.dros performed on 2019-03-15 15:47:19 has no hits.

LD07760.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:48:28 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6688893..6689396 439..942 100 <- Minus
chr3R 6692066..6692230 274..438 100 <- Minus
chr3R 6692346..6692513 106..273 100 <- Minus
chr3R 6693976..6694080 1..105 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:27 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RE 58..627 93..662 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:42:26 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RE 58..627 93..662 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:40:31 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RE 58..627 93..662 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:31:16 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RE 58..627 93..662 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:54 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RE 58..627 93..662 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:52:10 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RB 115..1056 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:42:26 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RB 115..1056 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:40:31 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RB 100..1041 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:31:16 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RB 115..1056 1..942 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:54 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RB 100..1041 1..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:28 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10863355..10863858 439..942 100 <- Minus
3R 10866529..10866693 274..438 100 <- Minus
3R 10866809..10866976 106..273 100 <- Minus
3R 10868439..10868543 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:28 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10863355..10863858 439..942 100 <- Minus
3R 10866529..10866693 274..438 100 <- Minus
3R 10866809..10866976 106..273 100 <- Minus
3R 10868439..10868543 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:28 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10863355..10863858 439..942 100 <- Minus
3R 10866529..10866693 274..438 100 <- Minus
3R 10866809..10866976 106..273 100 <- Minus
3R 10868439..10868543 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:40:31 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6689077..6689580 439..942 100 <- Minus
arm_3R 6692251..6692415 274..438 100 <- Minus
arm_3R 6692531..6692698 106..273 100 <- Minus
arm_3R 6694161..6694265 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:48 Download gff for LD07760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10604186..10604689 439..942 100 <- Minus
3R 10607360..10607524 274..438 100 <- Minus
3R 10607640..10607807 106..273 100 <- Minus
3R 10609270..10609374 1..105 100   Minus

LD07760.pep Sequence

Translation from 161 to 661

> LD07760.pep
MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQ
CIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPGGNILLLI
AHPERIRTEVRCARCNAHMGHVFEDGPKPTRKRYCINSASIEFVNADPAT
SSPPVATPTAAPIAQQ*

LD07760.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16176-PA 251 GF16176-PA 42..251 1..166 803 74.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17257-PA 238 GG17257-PA 42..238 1..166 794 79.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18739-PA 200 GH18739-PA 1..200 1..166 689 68 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
SelR-PB 166 CG6584-PB 1..166 1..166 899 100 Plus
SelR-PE 208 CG6584-PE 43..208 1..166 899 100 Plus
SelR-PI 155 CG6584-PI 1..155 1..166 820 93.4 Plus
SelR-PA 155 CG6584-PA 1..155 1..166 820 93.4 Plus
SelR-PC 197 CG6584-PC 43..197 1..166 820 93.4 Plus
SelR-PH 150 CG6584-PH 1..147 1..152 675 80.4 Plus
SelR-PJ 192 CG6584-PJ 43..189 1..152 675 80.4 Plus
SelR-PG 157 CG6584-PG 1..154 1..152 670 79.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24656-PA 211 GI24656-PA 1..211 1..166 754 70.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12062-PA 205 GL12062-PA 1..205 1..166 671 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19702-PE 203 GA19702-PE 37..203 1..166 797 89.8 Plus
Dpse\GA19702-PB 167 GA19702-PB 1..167 1..166 791 89.8 Plus
Dpse\GA19702-PD 156 GA19702-PD 1..156 1..166 710 83.2 Plus
Dpse\GA19702-PF 148 GA19702-PF 1..141 1..152 651 77.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26142-PA 250 GM26142-PA 43..250 1..166 835 78.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20695-PA 251 GD20695-PA 43..251 1..166 814 77.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24030-PA 200 GJ24030-PA 1..200 1..166 706 70 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13287-PA 209 GK13287-PA 1..209 1..166 665 67.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24659-PA 252 GE24659-PA 45..252 1..166 846 78.8 Plus

LD07760.hyp Sequence

Translation from 161 to 661

> LD07760.hyp
MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQ
CIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPGGNILLLI
AHPERIRTEVRCARCNAHMGHVFEDGPKPTRKRYCINSASIEFVNADPAT
SSPPVATPTAAPIAQQ*

LD07760.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
SelR-PB 166 CG6584-PB 1..166 1..166 899 100 Plus
SelR-PE 208 CG6584-PE 43..208 1..166 899 100 Plus
SelR-PI 155 CG6584-PI 1..155 1..166 820 93.4 Plus
SelR-PA 155 CG6584-PA 1..155 1..166 820 93.4 Plus
SelR-PC 197 CG6584-PC 43..197 1..166 820 93.4 Plus