Clone LD07775 Report

Search the DGRC for LD07775

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:77
Well:75
Vector:pBS SK-
Associated Gene/Transcriptsmt3-RA
Protein status:LD07775.pep: gold
Preliminary Size:897
Sequenced Size:689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4494 2001-01-01 Release 2 assignment
CG4494 2001-10-10 Blastp of sequenced clone
smt3 2008-04-29 Release 5.5 accounting
smt3 2008-08-15 Release 5.9 accounting
smt3 2008-12-18 5.12 accounting

Clone Sequence Records

LD07775.complete Sequence

689 bp (689 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061090

> LD07775.complete
CAAAAGGAAGCCGCTTGTGATAAATTTCAACTTCCATCAGCAAGCACTGA
ATTTGAGGAAATCAGCACGCCCGGCATTCGACGCTCCGCAAAAGAAAAAA
AAAACTTTTTTGACCACTTAGCAGCTTCAACAAGCAACCAAAAAATCAAC
ATGTCTGACGAAAAGAAGGGAGGTGAGACCGAGCACATCAACCTGAAGGT
CCTCGGCCAGGACAACGCCGTCGTCCAGTTCAAGATCAAGAAGCACACAC
CCTTGAGGAAGCTGATGAACGCCTACTGCGACCGTGCCGGACTCTCCATG
CAGGTGGTGCGCTTCCGTTTCGACGGACAGCCCATCAACGAGAACGACAC
TCCGACCTCGCTGGAGATGGAGGAGGGCGACACCATCGAGGTTTACCAGC
AGCAGACTGGTGGCGCTCCATAAGATTACTTAGTTAAGTTAGTTACTCCT
CTTACAACTACACACTTAAAACGAAAAAGAAAAAAATACAAGAAAAACCA
CAAAAGCAAAAACACAACAACAACAACATGAAGAATCCAACAAACCAGGC
CCTAAGAATCGATTGAATATGCTTTTAGTACAACTGTAGATTCTAAATGC
GTCTGTGTGCGTAAATAACAAAAACATTTGCAGACAAGAAAATGGTAAAT
AAAGCATTTTATAAACTACACAAAAAAAAAAAAAAAAAA

LD07775.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-RA 953 smt3-RA 180..854 1..675 3375 100 Plus
smt3.a 640 smt3.a 85..640 120..675 2780 100 Plus
nc_1515.a 503 nc_1515.a 1..401 469..69 2005 100 Minus
smt3.a 640 smt3.a 22..88 1..67 335 100 Plus
nc_1515.a 503 nc_1515.a 418..482 65..1 325 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6965857..6966463 671..63 2965 99.5 Minus
chr2L 23010047 chr2L 6966584..6966648 65..1 325 100 Minus
chrU 10048995 chrU 7157988..7158072 1..85 320 91.8 Plus
chr3RHet 2517486 chr3RHet 138663..138747 1..85 320 91.8 Plus
chrU 10048995 chrU 900519..900603 85..1 305 90.6 Minus
chrU 10048995 chrU 8275220..8275304 85..1 305 90.6 Minus
chrU 10048995 chrU 8784409..8784493 1..85 305 90.6 Plus
chrU 10048995 chrU 9980195..9980279 1..85 305 90.6 Plus
chr2RHet 3288813 chr2RHet 3077848..3077932 1..85 305 90.6 Plus
chrU 10048995 chrU 3036545..3036587 1..43 200 97.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6966776..6967388 675..63 3065 100 Minus
2L 23513712 2L 6967508..6967572 65..1 325 100 Minus
U 3151297 U 1159436..1159520 1..85 320 91.8 Plus
3R 32079331 3R 1295636..1295720 85..1 320 91.8 Minus
U 3151297 U 2193912..2193996 1..85 305 90.6 Plus
U 3151297 U 2395891..2395975 85..1 305 90.6 Minus
Y 3667352 Y 2005149..2005233 1..85 305 90.6 Plus
Y 3667352 Y 2114725..2114809 1..85 305 90.6 Plus
3L 28110227 3L 27654227..27654311 85..1 305 90.6 Minus
3CEN 744266 3CEN 24788..24830 1..43 200 97.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6966776..6967388 675..63 3065 100 Minus
2L 23513712 2L 6967508..6967572 65..1 325 100 Minus
3R 31820162 3R 1093214..1093298 85..1 320 91.7 Minus
Y 3410481 Y 2213834..2213918 1..85 305 90.5 Plus
Y 3410481 Y 2104258..2104342 1..85 305 90.5 Plus
3L 28103327 3L 27647327..27647411 85..1 305 90.5 Minus
Unmapped_scaffold_01 76224 Unmapped_scaffold_01 24788..24830 1..43 200 97.6 Plus
Blast to na_te.dros performed 2019-03-16 21:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 484..547 1..64 158 71.9 Plus

LD07775.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:39:56 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6965857..6966001 527..671 100 == Minus
chr2L 6966061..6966460 66..467 99 <- Minus
chr2L 6966584..6966611 38..65 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:37 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 1..273 151..423 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:42 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 1..273 151..423 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:03:41 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 1..273 151..423 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:30 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 1..273 151..423 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:26:57 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 1..273 151..423 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:04 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 22..692 1..671 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:42 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 22..692 1..671 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:03:41 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 73..743 1..671 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:30 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 22..692 1..671 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:26:57 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 73..743 1..671 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:56 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6966780..6967385 66..671 100 <- Minus
2L 6967508..6967572 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:56 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6966780..6967385 66..671 100 <- Minus
2L 6967508..6967572 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:39:56 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6966780..6967385 66..671 100 <- Minus
2L 6967508..6967572 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:03:41 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6966780..6967385 66..671 100 <- Minus
arm_2L 6967508..6967572 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:25 Download gff for LD07775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6966780..6967385 66..671 100 <- Minus
2L 6967508..6967572 1..65 100   Minus

LD07775.hyp Sequence

Translation from 0 to 422

> LD07775.hyp
QKEAACDKFQLPSASTEFEEISTPGIRRSAKEKKNFFDHLAASTSNQKIN
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP*

LD07775.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-PB 90 CG4494-PB 1..90 51..140 471 100 Plus
smt3-PA 90 CG4494-PA 1..90 51..140 471 100 Plus

LD07775.pep Sequence

Translation from 150 to 422

> LD07775.pep
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP*

LD07775.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14461-PA 91 GF14461-PA 1..89 1..89 475 100 Plus
Dana\GF12436-PA 376 GF12436-PA 45..128 2..85 204 46.4 Plus
Dana\GF19440-PA 90 GF19440-PA 2..79 11..88 183 41 Plus
Dana\GF22492-PA 164 GF22492-PA 73..158 2..87 137 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23561-PA 90 GG23561-PA 1..89 1..89 476 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13578-PA 96 GH13578-PA 1..89 1..89 469 98.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-PB 90 CG4494-PB 1..90 1..90 471 100 Plus
smt3-PA 90 CG4494-PA 1..90 1..90 471 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24172-PA 90 GI24172-PA 1..89 1..89 470 98.9 Plus
Dmoj\GI10913-PA 101 GI10913-PA 1..88 1..89 446 96.6 Plus
Dmoj\GI19359-PA 102 GI19359-PA 13..94 12..90 166 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25593-PA 90 GL25593-PA 1..88 1..88 469 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18220-PA 90 GA18220-PA 1..88 1..88 469 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13677-PA 90 GM13677-PA 1..90 1..90 481 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22523-PA 90 GD22523-PA 1..90 1..90 481 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21441-PA 90 GJ21441-PA 1..89 1..89 470 98.9 Plus
Dvir\GJ18559-PA 101 GJ18559-PA 1..87 1..88 442 96.6 Plus
Dvir\GJ19914-PA 102 GJ19914-PA 12..89 12..89 177 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18100-PA 96 GK18100-PA 1..89 1..89 463 97.8 Plus
Dwil\GK24974-PA 92 GK24974-PA 1..87 1..88 447 97.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18385-PA 90 GE18385-PA 1..89 1..89 476 100 Plus