Clone LD07939 Report

Search the DGRC for LD07939

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:79
Well:39
Vector:pBS SK-
Associated Gene/TranscriptCG10425-RA
Protein status:LD07939.pep: gold
Preliminary Size:1503
Sequenced Size:1370

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10425 2001-01-01 Release 2 assignment
CG10425 2001-11-09 Blastp of sequenced clone
CG10425 2003-01-01 Sim4 clustering to Release 3
CG10425 2008-04-29 Release 5.5 accounting
CG10425 2008-08-15 Release 5.9 accounting
CG10425 2008-12-18 5.12 accounting

Clone Sequence Records

LD07939.complete Sequence

1370 bp (1370 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069373

> LD07939.complete
AGAGATTAGAGAATCCGGGAATTATCGCACCCTCTTGAAATTGTCATCAT
GGAACTGAGCTGGGAGATAGTGTTCTGCGTGGGCATTGCGGTGCTGGTTC
ATGTTCTGGTCTACGTGTTCGTCATGGCCAAGAAACCGAGGAGCATTGTG
GGTCGTCATGTGGTGGTCACCGGCGGCTCCAAGGGAATCGGACTCTGTCT
GGCGGTGGAGTGCGCCATGAAAGGCGCCAATGTGACGGTGATAGCGCGCG
ACGAGAAAATGCTGAGCGGAGCAGTGGCTCTGATGGAAGTGATTCGCCAG
CGGCCAGATCAAAAGTTCCAGTACAGAAGTCTGGACATAAGCGGCGATTA
TGACCAGGTGGCCAAAGTGCTTGGCGAGATCGAAGATAGCTTCGGCCCCA
TATACACTTTAATAAACTGTGCCGGAATGGCCATTTGCGGTGTGTTCGAG
GAGGTCTCAGTCCAGGATGTCCACAAGCTGATGAACGTAAACTTCTTCGG
CACCTATAACTGCACCCGTTATGTCCTGCCCAAAATGAAGAAAGCCGGCG
ACGGCATTATTGTAATCACTGCCTCACAGGCGGCTATGTTTGGCATCTAT
GGATACGGTCCTTACTCAGCCACCAAGTACGCCCTGAGAGCGATGGCTGA
AACGATTGCAATGGAGTCTCGGGAGCACGGGGTCAGCGTCACTCTGGCCA
TGCCCTGCGATACGAATACACCCGGATTCGAGGAGGAGGAGAAGTCAAAG
CCCAGGGAAACCAAAATAATCTCTGGTGGAGGAGGTCTCATAGAGCCGGA
AGTTATGGCGAAAGCTATACTTAAGGATGCCCTGAAGGGAAAATTCACCT
CAACTGTTGGAGCAGAAAGCTGGCTGATCACCACTTTGGGTGGAGCATTG
CTTCCTTGGGATGGCTTCTTCACCAATCTTCTGCACGCCATAGTTTTGGG
ACCACTGCGAATAGTTAGCTACGCTCTGCACAAGTACTTCAATAGTGTTA
TACGCAAATGCGCTCGAGAGGATAAGGCCAAGGCCACATCGCAAGTGGAG
TCCAAGTGAAATCTCTCTTGTCCCGCTGCCCTTAAAGTATTCCCAAGTGC
CCATAATTAAATCACTTTTTTATAATTAATCAAAATGTGCGATTGTTTTG
CATGGTTAGCCTATTCATATATTACAATTCCCGTATTATCATTCATTTTT
ATATATATATTTGTATGTGCATTTGAACTTTTTTATTATTGCCGTGCTAG
GGTTTTAACTATTTGTATCGTGTTTTCTAGACTAGATGACGTGTGCTCGT
TTTGTTGGTGTGTGCTTCGTTTTAACAAAAATAAAATGTATTTACTGTTC
AGAAAAAAAAAAAAAAAAAA

LD07939.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG10425-RA 1448 CG10425-RA 90..1445 1..1356 6780 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21084628..21085196 834..266 2845 100 Minus
chr3R 27901430 chr3R 21084046..21084564 1352..834 2595 100 Minus
chr3R 27901430 chr3R 21085266..21085531 266..1 1330 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25261545..25262113 834..266 2845 100 Minus
3R 32079331 3R 25260959..25261481 1356..834 2615 100 Minus
3R 32079331 3R 25262183..25262448 266..1 1330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25002376..25002944 834..266 2845 100 Minus
3R 31820162 3R 25001790..25002312 1356..834 2615 100 Minus
3R 31820162 3R 25003014..25003279 266..1 1330 100 Minus
Blast to na_te.dros performed 2019-03-16 04:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
transib1 2167 transib1 TRANSIB1 2167bp 290..360 1202..1278 127 70.5 Plus

LD07939.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:03:28 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21085267..21085531 1..265 100   Minus
chr3R 21084046..21084563 835..1352 100 <- Minus
chr3R 21084628..21085196 266..834 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:53 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 1..1011 49..1059 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:30:13 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 1..1011 49..1059 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:56 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 1..1011 49..1059 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:57:51 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 1..1011 49..1059 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:13 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 1..1011 49..1059 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:08:07 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 47..1398 1..1352 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:30:13 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 62..1413 1..1352 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:56 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 51..1402 1..1352 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:09 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 47..1398 1..1352 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:13 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
CG10425-RA 51..1402 1..1352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:28 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25260963..25261480 835..1352 100 <- Minus
3R 25261545..25262113 266..834 100 <- Minus
3R 25262184..25262448 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:28 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25260963..25261480 835..1352 100 <- Minus
3R 25261545..25262113 266..834 100 <- Minus
3R 25262184..25262448 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:03:28 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25260963..25261480 835..1352 100 <- Minus
3R 25261545..25262113 266..834 100 <- Minus
3R 25262184..25262448 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:56 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21086685..21087202 835..1352 100 <- Minus
arm_3R 21087267..21087835 266..834 100 <- Minus
arm_3R 21087906..21088170 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:34:11 Download gff for LD07939.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25001794..25002311 835..1352 100 <- Minus
3R 25002376..25002944 266..834 100 <- Minus
3R 25003015..25003279 1..265 100   Minus

LD07939.hyp Sequence

Translation from 48 to 1058

> LD07939.hyp
MELSWEIVFCVGIAVLVHVLVYVFVMAKKPRSIVGRHVVVTGGSKGIGLC
LAVECAMKGANVTVIARDEKMLSGAVALMEVIRQRPDQKFQYRSLDISGD
YDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFEEVSVQDVHKLMNVNFF
GTYNCTRYVLPKMKKAGDGIIVITASQAAMFGIYGYGPYSATKYALRAMA
ETIAMESREHGVSVTLAMPCDTNTPGFEEEEKSKPRETKIISGGGGLIEP
EVMAKAILKDALKGKFTSTVGAESWLITTLGGALLPWDGFFTNLLHAIVL
GPLRIVSYALHKYFNSVIRKCAREDKAKATSQVESK*

LD07939.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG10425-PA 336 CG10425-PA 1..336 1..336 1723 100 Plus
CG15629-PA 325 CG15629-PA 49..247 28..227 209 29.1 Plus
CG7322-PC 242 CG7322-PC 5..177 33..219 195 31.6 Plus
CG7322-PB 242 CG7322-PB 5..177 33..219 195 31.6 Plus
CG7322-PA 242 CG7322-PA 5..177 33..219 195 31.6 Plus

LD07939.pep Sequence

Translation from 48 to 1058

> LD07939.pep
MELSWEIVFCVGIAVLVHVLVYVFVMAKKPRSIVGRHVVVTGGSKGIGLC
LAVECAMKGANVTVIARDEKMLSGAVALMEVIRQRPDQKFQYRSLDISGD
YDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFEEVSVQDVHKLMNVNFF
GTYNCTRYVLPKMKKAGDGIIVITASQAAMFGIYGYGPYSATKYALRAMA
ETIAMESREHGVSVTLAMPCDTNTPGFEEEEKSKPRETKIISGGGGLIEP
EVMAKAILKDALKGKFTSTVGAESWLITTLGGALLPWDGFFTNLLHAIVL
GPLRIVSYALHKYFNSVIRKCAREDKAKATSQVESK*

LD07939.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17432-PA 332 GF17432-PA 1..332 1..332 1642 91.3 Plus
Dana\GF18273-PA 321 GF18273-PA 19..308 11..295 216 25.9 Plus
Dana\GF19246-PA 242 GF19246-PA 7..197 35..235 196 30.6 Plus
Dana\GF15490-PA 325 GF15490-PA 49..310 28..302 194 27.3 Plus
Dana\GF23376-PA 334 GF23376-PA 16..236 26..237 192 26.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12271-PA 336 GG12271-PA 1..336 1..336 1727 95.8 Plus
Dere\GG25019-PA 325 GG25019-PA 49..310 28..302 194 27.7 Plus
Dere\GG17944-PA 598 GG17944-PA 12..198 35..220 186 29.7 Plus
Dere\GG18088-PA 242 GG18088-PA 5..178 33..220 174 31.7 Plus
Dere\GG19147-PA 255 GG19147-PA 8..198 39..225 170 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18974-PA 340 GH18974-PA 1..335 1..335 1532 80.6 Plus
Dgri\GH17658-PA 242 GH17658-PA 10..178 38..220 182 30.1 Plus
Dgri\GH12555-PA 601 GH12555-PA 11..196 35..219 182 28.9 Plus
Dgri\GH11705-PA 328 GH11705-PA 52..298 28..286 180 27.9 Plus
Dgri\GH18214-PA 370 GH18214-PA 82..270 16..208 179 26.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG10425-PA 336 CG10425-PA 1..336 1..336 1723 100 Plus
CG15629-PA 325 CG15629-PA 49..247 28..227 209 29.1 Plus
CG13833-PA 321 CG13833-PA 15..235 7..219 201 25.8 Plus
firl-PE 318 CG14946-PE 31..272 11..259 198 27.7 Plus
firl-PC 318 CG14946-PC 31..272 11..259 198 27.7 Plus
firl-PD 318 CG14946-PD 31..272 11..259 198 27.7 Plus
CG7322-PC 242 CG7322-PC 5..177 33..219 195 31.6 Plus
CG7322-PB 242 CG7322-PB 5..177 33..219 195 31.6 Plus
CG7322-PA 242 CG7322-PA 5..177 33..219 195 31.6 Plus
CG17121-PA 361 CG17121-PA 73..261 16..208 185 24.9 Plus
Mfe2-PB 598 CG3415-PB 12..197 35..219 184 29.4 Plus
Mfe2-PA 598 CG3415-PA 12..197 35..219 184 29.4 Plus
CG7601-PA 326 CG7601-PA 15..236 5..219 173 25.6 Plus
CG13284-PE 325 CG13284-PE 48..320 30..328 157 27.2 Plus
CG13284-PA 325 CG13284-PA 48..320 30..328 157 27.2 Plus
CG13284-PC 338 CG13284-PC 61..333 30..328 157 27.2 Plus
CG13284-PD 339 CG13284-PD 62..334 30..328 157 27.2 Plus
CG13284-PB 339 CG13284-PB 62..334 30..328 157 27.2 Plus
CG3699-PA 251 CG3699-PA 2..248 32..294 154 26.2 Plus
CG31548-PA 256 CG31548-PA 2..189 32..224 150 26.3 Plus
rdhB-PB 248 CG7077-PB 13..193 39..220 149 28.6 Plus
rdhB-PA 248 CG7077-PA 13..193 39..220 149 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24135-PA 343 GI24135-PA 1..335 1..335 1560 84.2 Plus
Dmoj\GI21510-PA 242 GI21510-PA 10..178 38..220 203 32.2 Plus
Dmoj\GI11209-PA 596 GI11209-PA 11..197 35..220 193 28.5 Plus
Dmoj\GI16082-PA 327 GI16082-PA 51..312 28..302 191 26.5 Plus
Dmoj\GI10764-PA 355 GI10764-PA 60..255 9..208 180 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22109-PA 334 GL22109-PA 1..334 1..336 1440 77.7 Plus
Dper\GL27358-PA 319 GL27358-PA 45..275 30..265 214 28.5 Plus
Dper\GL21318-PA 350 GL21318-PA 118..286 38..220 196 32.1 Plus
Dper\GL19368-PA 325 GL19368-PA 113..310 95..302 191 28.8 Plus
Dper\GL15827-PA 597 GL15827-PA 11..196 35..219 174 28.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10311-PA 334 GA10311-PA 1..334 1..336 1445 77.7 Plus
Dpse\GA12556-PA 319 GA12556-PA 19..275 13..265 220 28.7 Plus
Dpse\GA20258-PA 242 GA20258-PA 10..178 38..220 197 32.1 Plus
Dpse\GA13859-PA 325 GA13859-PA 113..310 95..302 191 28.8 Plus
Dpse\GA17436-PA 597 GA17436-PA 11..196 35..219 174 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17737-PA 336 GM17737-PA 1..336 1..336 1746 97.3 Plus
Dsec\GM22780-PA 242 GM22780-PA 5..178 33..220 195 30.7 Plus
Dsec\GM18492-PA 325 GM18492-PA 49..310 28..302 195 27.3 Plus
Dsec\GM23600-PA 321 GM23600-PA 15..235 7..219 192 26.1 Plus
Dsec\GM12822-PA 335 GM12822-PA 6..236 16..237 183 26.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18220-PA 336 GD18220-PA 1..336 1..336 1755 97.9 Plus
Dsim\GD24467-PA 242 GD24467-PA 5..178 33..220 202 31.2 Plus
Dsim\GD18413-PA 321 GD18413-PA 15..242 7..224 193 26.6 Plus
Dsim\GD23300-PA 325 GD23300-PA 49..310 28..302 186 27 Plus
Dsim\GD17678-PA 326 GD17678-PA 15..236 5..219 172 25.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10959-PA 343 GJ10959-PA 1..339 1..336 1533 81.1 Plus
Dvir\GJ19048-PA 242 GJ19048-PA 10..164 38..206 197 33.7 Plus
Dvir\GJ18503-PA 596 GJ18503-PA 11..197 35..220 186 29 Plus
Dvir\GJ14365-PA 352 GJ14365-PA 63..252 15..208 177 26.2 Plus
Dvir\GJ16192-PA 327 GJ16192-PA 51..312 28..302 173 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14345-PA 338 GK14345-PA 1..335 1..334 1504 83.3 Plus
Dwil\GK20088-PA 242 GK20088-PA 10..178 38..220 210 32.8 Plus
Dwil\GK18150-PA 300 GK18150-PA 51..291 35..287 185 27 Plus
Dwil\GK11925-PA 329 GK11925-PA 23..213 34..219 184 28.7 Plus
Dwil\GK11608-PA 320 GK11608-PA 45..233 28..219 180 27.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10721-PA 336 GE10721-PA 1..336 1..336 1727 95.8 Plus
Dyak\GE15485-PA 242 GE15485-PA 5..178 33..220 203 31.7 Plus
Dyak\GE17252-PA 641 GE17252-PA 55..241 35..220 186 29.7 Plus
Dyak\GE18307-PA 325 GE18307-PA 113..310 95..302 185 27.9 Plus
Dyak\GE23991-PA 361 GE23991-PA 75..261 18..208 175 24.6 Plus