Clone LD07994 Report

Search the DGRC for LD07994

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:79
Well:94
Vector:pBS SK-
Associated Gene/TranscriptDmn-RA
Protein status:LD07994.pep: gold
Preliminary Size:1488
Sequenced Size:1359

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8269 2001-01-01 Release 2 assignment
CG8269 2001-10-10 Blastp of sequenced clone
CG8269 2003-01-01 Sim4 clustering to Release 3
Dmn 2008-04-29 Release 5.5 accounting
Dmn 2008-08-15 Release 5.9 accounting
Dmn 2008-12-18 5.12 accounting

Clone Sequence Records

LD07994.complete Sequence

1359 bp (1359 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061092

> LD07994.complete
ATCAGATCGAATTGATTGTTGTAAAAAAGGATTTTTGAAGGTTTATAATT
ATTTCGTTGCCAAAGGATTCCAAACACCGCCGTCGACGTGCCCACAATAA
TGGCCGATCCCAAGTTCCAGAACCTACCGGGAATAGCTTATGACCAGCCG
GACGTGTACGAAACTCCAGATGACCCGGAGCTCGATACATCCGACTACTA
CGAAGAGGAGCCGGAGAACGAAGCCATCGAGCGACTGCACATCTCGCCGA
GCGTCGCTCACAAGCGCTTCAGCGGAGCAACGGTCGAGGGGAGTGTGGAC
TTCACGGATCGCATTGGACGACGCATGTGCCGGGGTTACGATACGCGCGG
CTCCAGCGACTACGAGCTGGTTGGCCAGGGCGAGAAGGAGACGCCGGTGC
AGAAGTGCCAGCGCCTGCAGATCGAGATGAACGAGCTTCTGAACGAGGTG
GCCGCCTTGCAGGTGGACCGCAAGGTAGCCGACGAGGAGAAGCAGTCGTA
CGATGCGGTGGCCACGGTTATCAGCACGGCCCGAAAGGTGCTGGAGTCGC
TGAAGCTGGAGCAAGTGCTGGGCAAGGAGCAGACGCCTGGAAGTAAGCAG
GTGAAAGCACTCATTAGCCAGGTGGAGGAGTTCAAGCAGTCCGGCGTTCT
CACAGCCATACCCACGCCTGGCACCGATCTGGCGGCCACGGCCCGCGTAG
CCAGTCTAGAGCAGCGAATCTCGCAGCTGGAGAAGGTGCTGGGCGCTCAG
CCGGACAAGTTGAGCCGCCTTACCGCCGCCACCAACACCACCAATGTACT
AGAGGCAGTGCGTCATCTAAGCACCAAGGCGGCCCTGATACAGCCTGATA
AACTGGACACCATCGAGCAGCGCCTGACCTCGCTGGCCGGCAAGATGGAT
GCTATCGCCGAAAAGTCCAGCGGCAGTGCCCAGGACGCCAAACGAGATCA
GAAGATTACGGAACTATACGACATCGCGAAGCGCACGGAGCCAGTGGTGG
AAATACTGCCGCACGTCATCGAACGCATGCAAGCCCTCGAGGCCCTCCAT
AAATATGCAAACAATTTCGCCAAGATCATCGCAGAGATTGAGCAGAAGCA
GGGAACCATCACCACTAGCTTGGTGAACAACAAGGAGCTGCTGCATTCCG
TACAGGAGACTTTCGCCCAGAATCTGGAGACTATCAACAGCAAGGTGGCC
AAGGTGGAGCAGCGTGTGGCGGCCATATCGTCTGCCAAATGAGTGGATGC
ATACCATGCGTATTAAATAAACATAGCTTATATTTATGAAAGATACCTAT
AATAAAGAGATCTACATTCGAGTCCAGTTCCAGTCAAAAAAAAAAAAAAA
AAAAAAAAA

LD07994.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmn-RA 1489 Dmn-RA 52..1396 1..1345 6710 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4779627..4780548 136..1057 4610 100 Plus
chr2R 21145070 chr2R 4780614..4780892 1057..1335 1395 100 Plus
chr2R 21145070 chr2R 4779408..4779543 1..136 680 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8892074..8892995 136..1057 4610 100 Plus
2R 25286936 2R 8893061..8893349 1057..1345 1430 99.7 Plus
2R 25286936 2R 8891855..8891990 1..136 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8893273..8894194 136..1057 4610 100 Plus
2R 25260384 2R 8894260..8894548 1057..1345 1430 99.6 Plus
2R 25260384 2R 8893054..8893189 1..136 680 100 Plus
Blast to na_te.dros performed 2019-03-16 16:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 8159..8217 1262..1318 111 70.5 Plus

LD07994.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:32:33 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4780615..4780892 1058..1335 100   Plus
chr2R 4779408..4779542 1..135 100 -> Plus
chr2R 4779627..4780548 136..1057 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:40:56 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 1..1143 100..1242 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:40:54 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 1..1143 100..1242 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:19 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 1..1143 100..1242 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:09:56 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 1..1143 100..1242 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:32:12 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 1..1143 100..1242 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:22:45 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 16..1350 1..1335 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:40:54 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 16..1350 1..1335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:19 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 24..1358 1..1335 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:09:56 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 16..1350 1..1335 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:32:12 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
Dmn-RA 24..1358 1..1335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:32:33 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8891855..8891989 1..135 100 -> Plus
2R 8892074..8892995 136..1057 100 -> Plus
2R 8893062..8893339 1058..1335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:32:33 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8891855..8891989 1..135 100 -> Plus
2R 8892074..8892995 136..1057 100 -> Plus
2R 8893062..8893339 1058..1335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:32:33 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8891855..8891989 1..135 100 -> Plus
2R 8892074..8892995 136..1057 100 -> Plus
2R 8893062..8893339 1058..1335 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:19 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4779360..4779494 1..135 100 -> Plus
arm_2R 4779579..4780500 136..1057 100 -> Plus
arm_2R 4780567..4780844 1058..1335 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:46:04 Download gff for LD07994.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8893273..8894194 136..1057 100 -> Plus
2R 8894261..8894538 1058..1335 100   Plus
2R 8893054..8893188 1..135 100 -> Plus

LD07994.pep Sequence

Translation from 99 to 1241

> LD07994.pep
MADPKFQNLPGIAYDQPDVYETPDDPELDTSDYYEEEPENEAIERLHISP
SVAHKRFSGATVEGSVDFTDRIGRRMCRGYDTRGSSDYELVGQGEKETPV
QKCQRLQIEMNELLNEVAALQVDRKVADEEKQSYDAVATVISTARKVLES
LKLEQVLGKEQTPGSKQVKALISQVEEFKQSGVLTAIPTPGTDLAATARV
ASLEQRISQLEKVLGAQPDKLSRLTAATNTTNVLEAVRHLSTKAALIQPD
KLDTIEQRLTSLAGKMDAIAEKSSGSAQDAKRDQKITELYDIAKRTEPVV
EILPHVIERMQALEALHKYANNFAKIIAEIEQKQGTITTSLVNNKELLHS
VQETFAQNLETINSKVAKVEQRVAAISSAK*

LD07994.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12385-PA 380 GF12385-PA 1..380 1..380 1842 95 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23390-PA 380 GG23390-PA 1..380 1..380 1962 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23102-PA 379 GH23102-PA 1..379 1..380 1745 88.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
DCTN2-p50-PA 380 CG8269-PA 1..380 1..380 1881 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18927-PA 379 GI18927-PA 1..379 1..380 1731 87.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17128-PA 380 GL17128-PA 1..380 1..380 1772 90.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20943-PA 380 GA20943-PA 1..380 1..380 1769 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21071-PA 380 GM21071-PA 1..380 1..380 1979 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10607-PA 380 GD10607-PA 1..380 1..380 1984 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21298-PA 379 GJ21298-PA 1..379 1..380 1745 88.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20679-PA 381 GK20679-PA 1..381 1..380 1774 88.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19232-PA 380 GE19232-PA 1..380 1..380 1959 97.6 Plus

LD07994.hyp Sequence

Translation from 99 to 1241

> LD07994.hyp
MADPKFQNLPGIAYDQPDVYETPDDPELDTSDYYEEEPENEAIERLHISP
SVAHKRFSGATVEGSVDFTDRIGRRMCRGYDTRGSSDYELVGQGEKETPV
QKCQRLQIEMNELLNEVAALQVDRKVADEEKQSYDAVATVISTARKVLES
LKLEQVLGKEQTPGSKQVKALISQVEEFKQSGVLTAIPTPGTDLAATARV
ASLEQRISQLEKVLGAQPDKLSRLTAATNTTNVLEAVRHLSTKAALIQPD
KLDTIEQRLTSLAGKMDAIAEKSSGSAQDAKRDQKITELYDIAKRTEPVV
EILPHVIERMQALEALHKYANNFAKIIAEIEQKQGTITTSLVNNKELLHS
VQETFAQNLETINSKVAKVEQRVAAISSAK*

LD07994.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmn-PA 380 CG8269-PA 1..380 1..380 1881 100 Plus