Clone LD08427 Report

Search the DGRC for LD08427

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:84
Well:27
Vector:pBS SK-
Associated Gene/TranscriptCrk-RB
Protein status:LD08427.pep: gold
Preliminary Size:1229
Sequenced Size:1046

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1587 2001-01-01 Release 2 assignment
CG1587 2001-10-10 Blastp of sequenced clone
CG1587 2003-01-01 Sim4 clustering to Release 3
Crk 2008-04-29 Release 5.5 accounting
Crk 2008-08-15 Release 5.9 accounting
Crk 2008-12-18 5.12 accounting

Clone Sequence Records

LD08427.complete Sequence

1046 bp (1046 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061094

> LD08427.complete
AATTCTGGTATATAATAGGCTGTATGCTATATTTGCATTATATCACATAA
TTTCTATTTATTTAATCTGGACGGAATTTGTTGTAATTTGTCTAAGATAA
ACCTTAAACGGAAATGGATACATTTGACGTTTCTGATAGGAACAGCTGGT
ACTTTGGTCCCATGTCTAGACAGGATGCTACTGAAGTTTTGATGAACGAA
CGCGAGCGGGGAGTGTTTTTAGTCCGTGATAGTAACTCGATAGCAGGGGA
TTATGTACTTTGTGATCAAATCGTTTACCGCATTGGGGATCAGTCTTTTG
ACAATCTACCGAAACTCTTAACTTTTTACACTCTTCATTATTTGGATACA
ACCCCTTTAAAACGGCCTGCGTGTAGAAGGGTGGAAAAAGTAATAGGAAA
GTTCGATTTCGTTGGCAGCGATCAAGATGATTTACCTTTTCAAAGAGGTG
AAGTTTTAACAATAGTTCGAAAAGACGAGGATCAATGGTGGACTGCGCGT
AACTCCTCGGGGAAAATTGGTCAAATACCGGTTCCCTATATACAACAGTA
TGACGATTATATGGATGAAGATGCTATTGATAAAAACGAACCTTCCATTT
CGGGATCTAGCAATGTATTTGAAAGTACTCTTAAAAGGACAGATTTAAAT
CGAAAACTACCTGCATACGCCCGCGTAAAACAGTCAAGGGTCCCTAACGC
ATACGATAAGACTGCATTAAAATTGGAAATAGGTGACATTATTAAAGTCA
CTAAAACAAACATTAATGGGCAATGGGAGGGAGAATTAAATGGAAAAAAT
GGTCATTTTCCCTTCACGCACGTTGAATTTGTCGATGATTGTGATTTAAG
CAAAAACTCCACAGAAATATGCTAAATAGGAAGGAATGGAAGGAATTTCT
TTTGATAATTTTGATTTTTGAGCTAATTGTATGATTAATAAGTTGTGCAT
ACCAATTGTTAACATAATCAGAAAATTAAAATCTTATTAAGTAAAATAAA
AATAAACGGGTACGAAGGACATAATAAAAAAAAAAAAAAAAAAAAA

LD08427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Crk-RA 1503 Crk-RA 690..1455 264..1029 3830 100 Plus
Crk.e 1232 Crk.e 419..1184 264..1029 3830 100 Plus
Crk.a 1387 Crk.a 859..1339 549..1029 2405 100 Plus
Crk.a 1387 Crk.a 434..719 264..549 1430 100 Plus
Crk.a 1387 Crk.a 117..380 1..264 1320 100 Plus
Crk-RA 1503 Crk-RA 373..636 1..264 1320 100 Plus
Crk.e 1232 Crk.e 87..350 1..264 1320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 233385..233759 651..1025 1875 100 Plus
chr4 1351717 chr4 232233..232389 264..420 785 100 Plus
chr4 1351717 chr4 230936..231080 1..145 725 100 Plus
chr4 1351717 chr4 232448..232576 420..548 645 100 Plus
chr4 1351717 chr4 231150..231270 144..264 605 100 Plus
chr4 1351717 chr4 233219..233323 546..650 525 100 Plus
chr4 1351717 chr4 236762..236820 420..478 280 98.3 Plus
chr4 1351717 chr4 236645..236705 358..418 275 96.7 Plus
chr4 1351717 chr4 236602..236646 264..308 195 95.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 212791..213169 651..1029 1895 100 Plus
4 1348131 4 211639..211795 264..420 785 100 Plus
4 1348131 4 210342..210486 1..145 725 100 Plus
4 1348131 4 211854..211982 420..548 645 100 Plus
4 1348131 4 210556..210676 144..264 605 100 Plus
4 1348131 4 212625..212729 546..650 525 100 Plus
4 1348131 4 216168..216226 420..478 280 98.3 Plus
4 1348131 4 216051..216111 358..418 275 96.7 Plus
4 1348131 4 216008..216052 264..308 195 95.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 212791..213169 651..1029 1895 100 Plus
4 1331231 4 211639..211795 264..420 785 100 Plus
4 1331231 4 210342..210486 1..145 725 100 Plus
4 1331231 4 211854..211982 420..548 645 100 Plus
4 1331231 4 210556..210676 144..264 605 100 Plus
4 1331231 4 212625..212729 546..650 525 100 Plus
4 1331231 4 216168..216226 420..478 280 98.3 Plus
4 1331231 4 216051..216111 358..418 275 96.7 Plus
4 1331231 4 216008..216052 264..308 195 95.5 Plus
Blast to na_te.dros performed 2019-03-16 19:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1553..1607 949..890 118 70 Minus

LD08427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:06:08 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 230936..231080 1..145 100 -> Plus
chr4 231152..231269 146..263 100 -> Plus
chr4 232233..232388 264..419 100 -> Plus
chr4 232448..232576 420..548 100 -> Plus
chr4 233222..233323 549..650 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:41:13 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..762 114..875 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:02 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..762 114..875 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:45 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..762 114..875 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:50 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..762 114..875 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:00:26 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..762 114..875 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:05 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..1025 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:02 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 117..1141 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:45 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 119..1143 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:51 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 1..1025 1..1025 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:00:26 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
Crk-RB 119..1143 1..1025 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:08 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
4 212791..213165 651..1025 100   Plus
4 210342..210486 1..145 100 -> Plus
4 210558..210675 146..263 100 -> Plus
4 211639..211794 264..419 100 -> Plus
4 211854..211982 420..548 100 -> Plus
4 212628..212729 549..650 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:08 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
4 212791..213165 651..1025 100   Plus
4 210342..210486 1..145 100 -> Plus
4 210558..210675 146..263 100 -> Plus
4 211639..211794 264..419 100 -> Plus
4 211854..211982 420..548 100 -> Plus
4 212628..212729 549..650 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:08 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
4 212791..213165 651..1025 100   Plus
4 210342..210486 1..145 100 -> Plus
4 210558..210675 146..263 100 -> Plus
4 211639..211794 264..419 100 -> Plus
4 211854..211982 420..548 100 -> Plus
4 212628..212729 549..650 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:45 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 230968..231112 1..145 100 -> Plus
arm_4 231184..231301 146..263 100 -> Plus
arm_4 232265..232420 264..419 100 -> Plus
arm_4 232480..232608 420..548 100 -> Plus
arm_4 233254..233355 549..650 100 -> Plus
arm_4 233417..233791 651..1025 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:42 Download gff for LD08427.complete
Subject Subject Range Query Range Percent Splice Strand
4 212791..213165 651..1025 100   Plus
4 210342..210486 1..145 100 -> Plus
4 210558..210675 146..263 100 -> Plus
4 211639..211794 264..419 100 -> Plus
4 211854..211982 420..548 100 -> Plus
4 212628..212729 549..650 100 -> Plus

LD08427.pep Sequence

Translation from 113 to 874

> LD08427.pep
MDTFDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLC
DQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFV
GSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYM
DEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKT
ALKLEIGDIIKVTKTNINGQWEGELNGKNGHFPFTHVEFVDDCDLSKNST
EIC*

LD08427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23415-PA 342 GF23415-PA 1..256 1..243 993 72.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16379-PA 269 GG16379-PA 1..268 1..252 1257 88.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23941-PA 277 GH23941-PA 1..267 1..248 1111 78 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
Crk-PB 253 CG1587-PB 1..253 1..253 1347 100 Plus
Crk-PA 271 CG1587-PA 1..271 1..253 1318 93.4 Plus
Crk-PC 271 CG1587-PC 1..271 1..253 1318 93.4 Plus
Crk-PE 263 CG1587-PE 1..263 1..253 1249 90.4 Plus
Crk-PD 184 CG1587-PD 1..168 1..150 746 86.3 Plus
Crk-PH 64 CG1587-PH 1..53 1..53 267 96.2 Plus
Crk-PG 84 CG1587-PG 1..50 1..50 265 100 Plus
drk-PD 211 CG6033-PD 58..209 10..146 146 27 Plus
drk-PF 211 CG6033-PF 58..209 10..146 146 27 Plus
drk-PA 211 CG6033-PA 58..209 10..146 146 27 Plus
drk-PB 211 CG6033-PB 58..209 10..146 146 27 Plus
drk-PC 211 CG6033-PC 58..209 10..146 146 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14066-PA 293 GI14066-PA 1..279 1..253 1060 73.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18154-PA 297 GL18154-PA 1..285 1..252 1125 75.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13993-PA 297 GA13993-PA 1..285 1..252 1125 75.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23242-PA 271 GM23242-PA 1..270 1..252 1322 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14194-PA 108 GD14194-PA 1..107 146..252 565 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18986-PA 298 GJ18986-PA 1..283 1..246 1084 74.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13611-PA 280 GK13611-PA 1..267 1..252 1129 79.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14540-PA 271 GE14540-PA 1..270 1..252 1309 92.2 Plus

LD08427.hyp Sequence

Translation from 113 to 874

> LD08427.hyp
MDTFDVSDRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLC
DQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRVEKVIGKFDFV
GSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYM
DEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQSRVPNAYDKT
ALKLEIGDIIKVTKTNINGQWEGELNGKNGHFPFTHVEFVDDCDLSKNST
EIC*

LD08427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Crk-PB 253 CG1587-PB 1..253 1..253 1347 100 Plus
Crk-PA 271 CG1587-PA 1..271 1..253 1318 93.4 Plus
Crk-PC 271 CG1587-PC 1..271 1..253 1318 93.4 Plus
Crk-PE 263 CG1587-PE 1..263 1..253 1249 90.4 Plus
Crk-PD 184 CG1587-PD 1..168 1..150 746 86.3 Plus