Clone LD08659 Report

Search the DGRC for LD08659

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:86
Well:59
Vector:pBS SK-
Associated Gene/TranscriptCG3358-RE
Protein status:LD08659.pep: gold
Preliminary Size:1165
Sequenced Size:969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3358 2001-01-01 Release 2 assignment
CG3358 2002-06-13 Blastp of sequenced clone
CG3358 2003-01-01 Sim4 clustering to Release 3
CG3358 2008-04-29 Release 5.5 accounting
CG3358 2008-08-15 Release 5.9 accounting
CG3358 2008-12-18 5.12 accounting

Clone Sequence Records

LD08659.complete Sequence

969 bp (969 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122155

> LD08659.complete
GCTTGACTAGCTAACACCTGGCAATGCTCCACAGACATTGGGGCCAACCT
GACGGACCCCATGTTCCAGGGCTGCTACGGCGGAACCCAGAAGCACGAGC
CCGACCTGCACATCGTCTTGGAGCGCGCGTGGCAACAGGGACTGCAGAAA
GTCATCGTTACCGCCGGCTGCCTGAAGGATGTGGATGAGGCACTGGAACT
GGCCTCCAAGGATGAGCGCATCTACACGACAGTGGGAACACATCCCACCC
GGTGCGAGGAATTCGTACCAGACCCAGAGGGCTACTATGACCAGTTGCGA
TCCAGGATCAAGGCAAATCGAACCAAGGTGCGGGCCGTAGGAGAATGTGG
TCTAGACTACGATCGCTTGCACTTCTGCGCCCAGGAAACCCAGCGTCTGT
ACTTCGAGAAGCAGCTGGACCTAGCGGCCGAGTTCAAACTGCCTCTCTTT
CTGCACATGAGAAATGCTGCCGAGGACTTCATGGGCATCCTGGAAAGAAA
TCGGAACAAGATCGAGGAGTGCGGCGGCGGAGTGGTGCACAGCTTTACAG
GAACTTTGGAGGAGGCCCAGCGCATCCTCGCCTTCGGCGGTCTCTACATA
GGCTTCAATGGGTGCTCCCTAAAGACGGATGAAAACGCAGAAGTGGTGCG
CAAGCTACCCAACGACAGGATAATGCTAGAAACCGACTGCCCGTGGTGTG
GTATTCGACCCTCGCATGCTGGACACAAGCACGTGACCACCAAGTTTCCC
ACCGTCAAGAAGAAAGAGAAATGGACAGCTGAATCCCTAATAGACGGACG
CTGTGAGCCTTGCCAAATCAGCCAAGTTTTGGAGTCTATTGCCGGAATCA
AACAAGAGCCTAAAGAACAGCTGGCTGCGTTATACTACCAAAACACATTG
GACTTGTTCTTCGGCACAGGAGAGAGTAAAGAATAAAACAACATGCATTT
AAAAAAAAAAAAAAAAAAA

LD08659.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3358.b 1426 CG3358.b 77..1027 1..951 4755 100 Plus
CG3358-RA 1149 CG3358-RA 77..1027 1..951 4755 100 Plus
CG3358.d 1944 CG3358.d 69..986 34..951 4590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2811270..2811877 214..821 3040 100 Plus
chr2R 21145070 chr2R 2810837..2811050 1..214 1070 100 Plus
chr2R 21145070 chr2R 2811942..2812072 820..950 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:54:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6923879..6924486 214..821 3040 100 Plus
2R 25286936 2R 6923446..6923659 1..214 1070 100 Plus
2R 25286936 2R 6924551..6924682 820..951 660 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6925078..6925685 214..821 3040 100 Plus
2R 25260384 2R 6924645..6924858 1..214 1070 100 Plus
2R 25260384 2R 6925750..6925881 820..951 660 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:09:25 has no hits.

LD08659.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:10:33 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2810837..2811050 1..214 100 -> Plus
chr2R 2811271..2811877 215..821 100 -> Plus
chr2R 2811944..2812072 822..950 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:41:29 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RC 19..921 34..936 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:37 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RC 19..921 34..936 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:57 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RE 1..876 61..936 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:27 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RC 19..921 34..936 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:29 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RE 1..876 61..936 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:47:51 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RA 76..1025 1..950 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:37 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RA 77..1026 1..950 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:57 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RE 1..950 1..950 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:27 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RA 76..1025 1..950 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:29 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
CG3358-RE 1..950 1..950 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:33 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6923446..6923659 1..214 100 -> Plus
2R 6924553..6924681 822..950 100   Plus
2R 6923880..6924486 215..821 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:33 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6923446..6923659 1..214 100 -> Plus
2R 6924553..6924681 822..950 100   Plus
2R 6923880..6924486 215..821 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:10:33 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6923446..6923659 1..214 100 -> Plus
2R 6924553..6924681 822..950 100   Plus
2R 6923880..6924486 215..821 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:57 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2810951..2811164 1..214 100 -> Plus
arm_2R 2811385..2811991 215..821 100 -> Plus
arm_2R 2812058..2812186 822..950 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:07 Download gff for LD08659.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6924645..6924858 1..214 100 -> Plus
2R 6925079..6925685 215..821 100 -> Plus
2R 6925752..6925880 822..950 100   Plus

LD08659.pep Sequence

Translation from 60 to 935

> LD08659.pep
MFQGCYGGTQKHEPDLHIVLERAWQQGLQKVIVTAGCLKDVDEALELASK
DERIYTTVGTHPTRCEEFVPDPEGYYDQLRSRIKANRTKVRAVGECGLDY
DRLHFCAQETQRLYFEKQLDLAAEFKLPLFLHMRNAAEDFMGILERNRNK
IEECGGGVVHSFTGTLEEAQRILAFGGLYIGFNGCSLKTDENAEVVRKLP
NDRIMLETDCPWCGIRPSHAGHKHVTTKFPTVKKKEKWTAESLIDGRCEP
CQISQVLESIAGIKQEPKEQLAALYYQNTLDLFFGTGESKE*

LD08659.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13149-PA 305 GF13149-PA 16..299 1..284 1358 86.3 Plus
Dana\GF17261-PA 318 GF17261-PA 40..315 4..283 294 31.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23234-PA 347 GG23234-PA 60..347 1..288 1411 89.6 Plus
Dere\GG14738-PA 319 GG14738-PA 41..316 4..283 286 31.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22015-PA 273 GH22015-PA 16..269 1..284 1093 72.9 Plus
Dgri\GH18916-PA 326 GH18916-PA 48..323 4..283 284 31.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG3358-PG 291 CG3358-PG 1..291 1..291 1559 100 Plus
CG3358-PF 291 CG3358-PF 1..291 1..291 1559 100 Plus
CG3358-PE 291 CG3358-PE 1..291 1..291 1559 100 Plus
CG3308-PA 319 CG3308-PA 47..316 10..283 272 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19721-PA 303 GI19721-PA 16..299 1..284 1257 79.9 Plus
Dmoj\GI10834-PA 313 GI10834-PA 35..310 4..283 287 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11128-PA 293 GL11128-PA 1..291 1..290 1333 82.5 Plus
Dper\GL15649-PA 185 GL15649-PA 1..183 109..290 846 84.7 Plus
Dper\GL27162-PA 321 GL27162-PA 43..318 4..283 287 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17403-PA 293 GA17403-PA 1..291 1..290 1345 83.5 Plus
Dpse\GA17263-PA 321 GA17263-PA 43..318 4..283 288 31.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20907-PA 306 GM20907-PA 16..306 1..291 1493 94.8 Plus
Dsec\GM15087-PA 310 GM15087-PA 41..301 4..267 268 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10435-PA 306 GD10435-PA 16..306 1..291 1495 95.2 Plus
Dsim\GD19994-PA 264 GD19994-PA 1..261 19..283 273 31.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17566-PA 303 GJ17566-PA 16..299 1..284 1272 81 Plus
Dvir\GJ14441-PA 324 GJ14441-PA 46..321 4..283 281 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20888-PA 304 GK20888-PA 16..299 1..284 1292 80.3 Plus
Dwil\GK12770-PA 312 GK12770-PA 34..309 4..283 289 31.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19085-PA 313 GE19085-PA 23..313 1..291 1447 91.1 Plus
Dyak\GE25001-PA 319 GE25001-PA 41..316 4..283 285 31.1 Plus

LD08659.hyp Sequence

Translation from 60 to 935

> LD08659.hyp
MFQGCYGGTQKHEPDLHIVLERAWQQGLQKVIVTAGCLKDVDEALELASK
DERIYTTVGTHPTRCEEFVPDPEGYYDQLRSRIKANRTKVRAVGECGLDY
DRLHFCAQETQRLYFEKQLDLAAEFKLPLFLHMRNAAEDFMGILERNRNK
IEECGGGVVHSFTGTLEEAQRILAFGGLYIGFNGCSLKTDENAEVVRKLP
NDRIMLETDCPWCGIRPSHAGHKHVTTKFPTVKKKEKWTAESLIDGRCEP
CQISQVLESIAGIKQEPKEQLAALYYQNTLDLFFGTGESKE*

LD08659.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG3358-PG 291 CG3358-PG 1..291 1..291 1559 100 Plus
CG3358-PF 291 CG3358-PF 1..291 1..291 1559 100 Plus
CG3358-PE 291 CG3358-PE 1..291 1..291 1559 100 Plus
CG3308-PA 319 CG3308-PA 47..316 10..283 272 31.4 Plus