Clone LD08717 Report

Search the DGRC for LD08717

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:87
Well:17
Vector:pBS SK-
Associated Gene/TranscriptProsbeta5-RA
Protein status:LD08717.pep: gold
Preliminary Size:1304
Sequenced Size:1136

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12323 2001-01-01 Release 2 assignment
CG12323 2001-11-29 Blastp of sequenced clone
CG12323 2003-01-01 Sim4 clustering to Release 3
Prosbeta5 2008-04-29 Release 5.5 accounting
Prosbeta5 2008-08-15 Release 5.9 accounting
Prosbeta5 2008-12-18 5.12 accounting

Clone Sequence Records

LD08717.complete Sequence

1136 bp (1136 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069381

> LD08717.complete
TAGGCAACGAATTTTGTTTGTCATCGGCATTTCGCATTCAACGTTTCCAA
TTGTTTTTTAAGGAGCTTTAAGAATGGCTTTAGCTGAAATCTGCAAGATA
TCGAATGCTCCGTACATGCGGCCCAATGCCTGGTCATCGGCGGATGTGGA
GGAAGAGCAAAAAGGGCTTATGTGCAATCTGGCCAATCCCTACACACTGG
CTGCTCCGCCATTCGAGAACCCCCTGCACAACCTTAATCAGATCCAGGCC
AATGGCGACAAGACCGGCGTCAAAATCAACTTCGATCACGGCACCACAAC
GTTGGGCTTCAAGTTCAAGGGCGGCGTTCTCCTGGCAGTCGATTCCCGTG
CCACGGGTGGATCGTACATTGGCTCCCAGTCGATGAAGAAGATCGTGGAG
ATCAATCAGTTCATGCTGGGCACCTTGGCCGGTGGCGCAGCCGATTGCGT
TTACTGGGACAGGGTCCTTTCGAAGGAATGCCGCCTTCACGAGCTTCGAA
ACAAGGAACGCATCTCGGTGGCCGCCGCCAGCAAGATAATGGCCAACATT
GCCCACGAATACAAGGGAATGGGTCTGAGCATGGGCATGATGCTGGCCGG
TTACGATAAGCGTGGTCCAGGCCTCTACTATGTGGACTCCGAGGGATCTC
GCACGCCTGGCAATTTGTTCTCTGTTGGTAGTGGATCGCTGTACGCCTAC
GGTGTCCTGGACTCTGGCTATCATTGGGACCTGGAGGACAAGGAGGCCCA
GGAGCTGGGACGTCGCGCCATCTACCATGCCACCTTCAGGGATGCCTACT
CCGGTGGTATCATTCGCGTGTATCACATTAAGGAGGACGGCTGGGTAAAC
ATCTCCAACACCGACTGCATGGAGCTGCACTACATGTACCAGGAGCAGTT
GAAGCAGCAGGCCGCTAAGTAGAGTTTTGATTAAGGGAATATAAGATATT
CAGTTTGTATACGTTTGAATTTCTTGGAATAAATAAACGTGCTAGAGACT
ATGTTTTGTGTATAATTGATTGGGCTAATTTGTTTTGCTTTTCATAGGTT
TATTACTATAAATGTAGTTGTATGTATGTAATGTATTTTTGGTAAATATA
ACAAGTACGCATATATTAAAAAAAAAAAAAAAAAAA

LD08717.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-RA 1199 Prosbeta5-RA 81..1199 1..1119 5595 100 Plus
Prosbeta5-RB 1126 Prosbeta5-RB 70..1126 63..1119 5285 100 Plus
Prosbeta5R-RA 1129 Prosbeta5R-RA 392..523 364..495 210 77.2 Plus
Prosbeta5R-RA 1129 Prosbeta5R-RA 588..628 560..600 145 90.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6707819..6708715 221..1117 4470 99.9 Plus
chr2R 21145070 chr2R 6707537..6707756 1..220 1100 100 Plus
chr2R 21145070 chr2R 19195520..19195756 600..364 255 73.8 Minus
chr2L 23010047 chr2L 17989603..17989648 557..602 185 93.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10820282..10821180 221..1119 4495 100 Plus
2R 25286936 2R 10820000..10820219 1..220 1100 100 Plus
2R 25286936 2R 23309152..23309388 600..364 255 73.8 Minus
2L 23513712 2L 17990976..17991021 557..602 185 93.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10821481..10822379 221..1119 4495 100 Plus
2R 25260384 2R 10821199..10821418 1..220 1100 100 Plus
2R 25260384 2R 23310456..23310587 495..364 210 77.2 Minus
2R 25260384 2R 23310351..23310391 600..560 145 90.2 Minus
Blast to na_te.dros performed on 2019-03-15 22:14:47 has no hits.

LD08717.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:15:41 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6707537..6707756 1..220 100 -> Plus
chr2R 6707819..6708715 221..1117 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:41:35 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 1..849 74..922 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:11 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 1..849 74..922 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:12:31 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 1..849 74..922 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:50:55 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 1..849 74..922 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:33 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 1..849 74..922 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:59:39 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 20..1136 1..1117 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:11 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 20..1136 1..1117 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:12:31 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 23..1139 1..1117 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:50:55 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 20..1136 1..1117 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:33 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 23..1139 1..1117 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:41 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10820000..10820219 1..220 100 -> Plus
2R 10820282..10821178 221..1117 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:41 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10820000..10820219 1..220 100 -> Plus
2R 10820282..10821178 221..1117 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:41 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10820000..10820219 1..220 100 -> Plus
2R 10820282..10821178 221..1117 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:12:31 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6707505..6707724 1..220 100 -> Plus
arm_2R 6707787..6708683 221..1117 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:22 Download gff for LD08717.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10821199..10821418 1..220 100 -> Plus
2R 10821481..10822377 221..1117 100   Plus

LD08717.pep Sequence

Translation from 73 to 921

> LD08717.pep
MALAEICKISNAPYMRPNAWSSADVEEEQKGLMCNLANPYTLAAPPFENP
LHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIG
SQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVA
AASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFS
VGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVY
HIKEDGWVNISNTDCMELHYMYQEQLKQQAAK*

LD08717.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13778-PA 284 GF13778-PA 1..275 1..275 1322 88 Plus
Dana\GF13303-PA 314 GF13303-PA 1..270 1..272 900 61.5 Plus
Dana\GF14807-PA 308 GF14807-PA 1..267 1..269 713 49.6 Plus
Dana\GF21399-PA 293 GF21399-PA 1..275 1..277 708 50.2 Plus
Dana\GF23798-PA 272 GF23798-PA 43..219 77..254 221 32 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20151-PA 282 GG20151-PA 1..269 1..269 1402 95.9 Plus
Dere\GG20051-PA 390 GG20051-PA 1..270 1..272 902 61.5 Plus
Dere\GG21097-PA 245 GG21097-PA 1..234 36..272 760 56.1 Plus
Dere\GG18789-PA 307 GG18789-PA 48..230 73..256 223 31 Plus
Dere\GG15711-PA 272 GG15711-PA 43..219 77..254 222 31.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20460-PA 280 GH20460-PA 1..269 1..269 1289 85.9 Plus
Dgri\GH23050-PA 315 GH23050-PA 1..270 1..272 876 59.6 Plus
Dgri\GH14538-PA 275 GH14538-PA 1..259 1..275 473 40.9 Plus
Dgri\GH16666-PA 272 GH16666-PA 43..227 77..262 228 31.7 Plus
Dgri\GH12772-PA 300 GH12772-PA 29..226 56..256 216 29.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-PA 282 CG12323-PA 1..282 1..282 1493 100 Plus
Prosbeta5-PB 282 CG12323-PB 1..282 1..282 1493 100 Plus
Prosbeta5R1-PA 315 CG9868-PA 1..270 1..272 882 61.2 Plus
Prosbeta5R2-PB 279 CG31742-PB 1..277 1..279 775 51.8 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..277 1..279 775 51.8 Plus
Prosbeta2-PA 272 CG3329-PA 39..219 73..254 237 33 Plus
Prosbeta2R1-PA 307 CG18341-PA 48..232 73..258 224 32.3 Plus
Prosbeta1-PA 224 CG8392-PA 15..198 73..256 215 28.1 Plus
Prosbeta2R2-PA 322 CG12161-PA 26..231 47..255 210 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18886-PA 279 GI18886-PA 1..275 1..275 1327 86.9 Plus
Dmoj\GI21121-PA 314 GI21121-PA 1..273 1..275 892 61.4 Plus
Dmoj\GI10892-PA 322 GI10892-PA 1..273 1..273 757 49.3 Plus
Dmoj\GI11352-PA 270 GI11352-PA 39..227 73..262 244 32.1 Plus
Dmoj\GI20414-PA 222 GI20414-PA 15..198 73..256 215 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11283-PA 305 GL11283-PA 1..254 1..272 818 58.6 Plus
Dper\GL14524-PA 270 GL14524-PA 1..262 1..272 573 41.5 Plus
Dper\GL21838-PA 312 GL21838-PA 49..235 73..260 229 30.3 Plus
Dper\GL24711-PA 272 GL24711-PA 43..220 77..255 228 32.4 Plus
Dper\GL17309-PA 991 GL17309-PA 1..62 1..62 223 67.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11556-PA 279 GA11556-PA 1..279 1..279 1310 84.6 Plus
Dpse\GA22086-PA 321 GA22086-PA 1..270 1..272 889 61.5 Plus
Dpse\GA25177-PA 270 GA25177-PA 1..263 1..273 575 41.7 Plus
Dpse\GA26418-PA 312 GA26418-PA 49..235 73..260 231 30.3 Plus
Dpse\GA17382-PA 272 GA17382-PA 43..220 77..255 224 31.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21240-PA 282 GM21240-PA 1..282 1..282 1494 97.5 Plus
Dsec\GM15565-PA 315 GM15565-PA 1..270 1..272 891 60.8 Plus
Dsec\GM17255-PA 279 GM17255-PA 1..278 1..280 791 50.9 Plus
Dsec\GM12440-PA 307 GM12440-PA 48..232 73..258 231 31.7 Plus
Dsec\GM25498-PA 272 GM25498-PA 43..219 77..254 224 32 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10758-PA 282 GD10758-PA 1..282 1..282 1496 97.9 Plus
Dsim\GD24120-PA 279 GD24120-PA 1..278 1..280 805 52.3 Plus
Dsim\GD16756-PA 307 GD16756-PA 48..232 73..258 229 31.2 Plus
Dsim\GD14518-PA 272 GD14518-PA 43..219 77..254 223 32 Plus
Dsim\GD19639-PA 322 GD19639-PA 26..231 47..255 205 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21921-PA 279 GJ21921-PA 1..279 1..279 1305 84.2 Plus
Dvir\GJ20967-PA 312 GJ20967-PA 1..276 1..277 861 59 Plus
Dvir\GJ16567-PA 328 GJ16567-PA 1..276 1..278 740 49.5 Plus
Dvir\GJ11606-PA 270 GJ11606-PA 41..218 77..255 228 32.4 Plus
Dvir\GJ16628-PA 304 GJ16628-PA 21..226 47..256 214 30 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15836-PA 283 GK15836-PA 1..281 1..281 1352 85.8 Plus
Dwil\GK19557-PA 362 GK19557-PA 1..277 1..279 902 60 Plus
Dwil\GK18059-PA 311 GK18059-PA 1..270 1..273 667 48.7 Plus
Dwil\GK25153-PA 353 GK25153-PA 50..224 73..247 253 34.7 Plus
Dwil\GK10550-PA 272 GK10550-PA 39..220 73..255 235 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Prosbeta5-PA 282 GE12841-PA 1..269 1..269 1403 95.9 Plus
Dyak\GE11586-PA 315 GE11586-PA 1..270 1..272 901 61.5 Plus
Dyak\GE12802-PA 246 GE12802-PA 1..243 36..281 767 55.3 Plus
Dyak\GE25306-PA 324 GE25306-PA 26..231 47..255 229 29.5 Plus
Dyak\GE22042-PA 272 GE22042-PA 43..219 77..254 221 32 Plus

LD08717.hyp Sequence

Translation from 73 to 921

> LD08717.hyp
MALAEICKISNAPYMRPNAWSSADVEEEQKGLMCNLANPYTLAAPPFENP
LHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIG
SQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVA
AASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFS
VGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVY
HIKEDGWVNISNTDCMELHYMYQEQLKQQAAK*

LD08717.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-PA 282 CG12323-PA 1..282 1..282 1493 100 Plus
Prosbeta5-PB 282 CG12323-PB 1..282 1..282 1493 100 Plus
Prosbeta5R1-PA 315 CG9868-PA 1..270 1..272 882 61.2 Plus
Prosbeta5R2-PB 279 CG31742-PB 1..277 1..279 775 51.8 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..277 1..279 775 51.8 Plus