Clone LD08762 Report

Search the DGRC for LD08762

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:87
Well:62
Vector:pBS SK-
Associated Gene/TranscriptCG13373-RA
Protein status:LD08762.pep: gold
Preliminary Size:810
Sequenced Size:621

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13373 2002-01-01 Sim4 clustering to Release 2
CG13373 2003-01-01 Sim4 clustering to Release 3
CG13373 2004-01-31 Blastp of sequenced clone
CG13373 2008-04-29 Release 5.5 accounting
CG13373 2008-08-15 Release 5.9 accounting
CG13373 2008-12-18 5.12 accounting

Clone Sequence Records

LD08762.complete Sequence

621 bp (621 high quality bases) assembled on 2004-01-31

GenBank Submission: BT014920

> LD08762.complete
TGCACGTCCCATCGAAGCTGAGTGTCTAACCCTCCTTTAAGTGTCTAACT
CAACTGGAACTCTCCGATTTTCTATTTCTTTCGCAGAGAAGACAATCAAA
ATGCTTTTCGATGGCGCAGCCGGCAATAGGCAGGGTCAGGGCCAGAATGC
CCTGAAGCCATTGGTACAAGGCCAGGAGGAGCCCGCCCTATGCGAGCAGT
ACTATCTGCTTGGCGATGGTTCCATCGTTCTGCGCAACCTTCGCACCGAC
TTGTCCAATCCGCGCCTGGAGAGAGTGAAATCGCGCTGCTGCCAGCGCCA
AACGCTCATCCACGACATATGCGTCAACTGCGTGATGGATCTCTGCGAGG
AGTGTGGCTACTCCTGCGGCGAGTGCTCCAGGTTCATTTGCCGCAGCTGC
GTGACTTTATTTGGTAATCGAGTTGAAGAAGAGAAGGATCCCCTGTGCGA
GCACTGCCAGATGTTCTTCAGCTAAGGCTTTACACAATCCAGCACTTATA
AAGTCGCGGTGCTTGTTAAATTTTAAGTTCTGAAGCAGTACAAATTTGGG
ACGACACAATGTCAAATGTATTACCAACCAGCTCCGTTTCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

LD08762.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13373-RA 593 CG13373-RA 1..591 1..591 2955 100 Plus
CG13373-RB 1019 CG13373-RB 411..916 86..591 2530 100 Plus
CG13373.a 1271 CG13373.a 411..916 86..591 2530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 371554..371964 1..411 2055 100 Plus
chrX 22417052 chrX 373628..373978 52..411 1210 89.7 Plus
chrX 22417052 chrX 376116..376466 52..411 1195 89.4 Plus
chrX 22417052 chrX 372046..372224 412..590 895 100 Plus
chrX 22417052 chrX 376551..376633 412..494 280 89.2 Plus
chrX 22417052 chrX 374063..374145 412..494 265 88 Plus
chrX 22417052 chrX 376779..376830 509..560 215 94.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 477521..477931 1..411 2055 100 Plus
X 23542271 X 479595..479945 52..411 1210 89.7 Plus
X 23542271 X 482083..482433 52..411 1195 89.4 Plus
X 23542271 X 478013..478192 412..591 900 100 Plus
X 23542271 X 482518..482600 412..494 280 89.2 Plus
X 23542271 X 480030..480112 412..494 265 88 Plus
X 23542271 X 482746..482797 509..560 215 94.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 485619..486029 1..411 2055 100 Plus
X 23527363 X 486111..486290 412..591 900 100 Plus
X 23527363 X 487672..487909 33..268 775 89 Plus
X 23527363 X 490160..490397 33..268 760 88.6 Plus
X 23527363 X 490396..490531 276..411 575 94.8 Plus
X 23527363 X 487908..488043 276..411 575 94.8 Plus
X 23527363 X 490616..490698 412..494 280 89.1 Plus
X 23527363 X 488128..488210 412..494 265 87.9 Plus
X 23527363 X 490810..490895 476..560 225 86 Plus
Blast to na_te.dros performed on 2019-03-16 19:05:35 has no hits.

LD08762.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:06:16 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 371554..371964 1..411 100 -> Plus
chrX 372046..372224 412..590 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:41:38 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RB 140..534 81..475 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:39 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RB 140..534 81..475 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:59 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RB 140..534 81..475 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:29 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RB 140..534 81..475 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:00:41 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RB 140..534 81..475 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:41 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:39 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:59 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 154..743 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:29 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:00:41 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 154..743 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:16 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
X 477521..477931 1..411 100 -> Plus
X 478013..478191 412..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:16 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
X 477521..477931 1..411 100 -> Plus
X 478013..478191 412..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:06:16 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
X 477521..477931 1..411 100 -> Plus
X 478013..478191 412..590 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:59 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 372046..372224 412..590 100   Plus
arm_X 371554..371964 1..411 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:54 Download gff for LD08762.complete
Subject Subject Range Query Range Percent Splice Strand
X 485619..486029 1..411 100 -> Plus
X 486111..486289 412..590 100   Plus

LD08762.hyp Sequence

Translation from 100 to 474

> LD08762.hyp
MLFDGAAGNRQGQGQNALKPLVQGQEEPALCEQYYLLGDGSIVLRNLRTD
LSNPRLERVKSRCCQRQTLIHDICVNCVMDLCEECGYSCGECSRFICRSC
VTLFGNRVEEEKDPLCEHCQMFFS*

LD08762.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13373-PA 124 CG13373-PA 1..124 1..124 683 100 Plus
CG13373-PB 177 CG13373-PB 54..177 1..124 683 100 Plus
CG3176-PD 121 CG3176-PD 1..121 1..124 557 81.5 Plus
CG3176-PA 121 CG3176-PA 1..121 1..124 557 81.5 Plus
CG32817-PB 121 CG32817-PB 1..121 1..124 549 80.6 Plus

LD08762.pep Sequence

Translation from 100 to 474

> LD08762.pep
MLFDGAAGNRQGQGQNALKPLVQGQEEPALCEQYYLLGDGSIVLRNLRTD
LSNPRLERVKSRCCQRQTLIHDICVNCVMDLCEECGYSCGECSRFICRSC
VTLFGNRVEEEKDPLCEHCQMFFS*

LD08762.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21455-PA 230 GF21455-PA 136..230 30..124 426 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12788-PA 389 GG12788-PA 285..389 20..124 482 82.9 Plus
Dere\GG12787-PA 121 GG12787-PA 17..121 20..124 463 82.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24415-PA 114 GH24415-PA 15..114 26..124 306 61 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13373-PA 124 CG13373-PA 1..124 1..124 683 100 Plus
CG13373-PB 177 CG13373-PB 54..177 1..124 683 100 Plus
CG3176-PD 121 CG3176-PD 1..121 1..124 557 81.5 Plus
CG3176-PA 121 CG3176-PA 1..121 1..124 557 81.5 Plus
CG32817-PB 121 CG32817-PB 1..121 1..124 549 80.6 Plus
CG32817-PC 121 CG32817-PC 1..121 1..124 549 80.6 Plus
CG32817-PA 121 CG32817-PA 1..121 1..124 549 80.6 Plus
CG3176-PC 101 CG3176-PC 1..100 1..103 447 80.6 Plus
CG3176-PB 101 CG3176-PB 1..100 1..103 447 80.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16312-PA 176 GI16312-PA 50..176 1..124 353 55.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20383-PA 78 GL20383-PA 1..76 47..122 280 69.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12237-PA 143 GA12237-PA 40..141 23..122 327 59.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19066-PA 234 GM19066-PA 54..157 1..104 493 91.3 Plus
Dsec\GM16244-PA 122 GM16244-PA 1..122 1..124 490 80.8 Plus
Dsec\GM16243-PA 122 GM16243-PA 1..122 1..124 490 80.8 Plus
Dsec\GM19067-PA 122 GM19067-PA 1..122 1..124 490 80.8 Plus
Dsec\GM23227-PA 104 GM23227-PA 1..96 1..98 366 77.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16505-PA 177 GD16505-PA 54..177 1..124 598 91.9 Plus
Dsim\GD16506-PA 122 GD16506-PA 1..122 1..124 436 76.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15649-PA 207 GJ15649-PA 113..207 30..124 352 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15991-PA 180 GK15991-PA 50..178 1..122 362 58.9 Plus
Dwil\GK15987-PA 158 GK15987-PA 53..158 22..124 329 59.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16613-PA 324 GE16613-PA 226..324 26..124 457 82.8 Plus