Clone LD09376 Report

Search the DGRC for LD09376

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:93
Well:76
Vector:pBS SK-
Associated Gene/Transcriptsta-RA
Protein status:LD09376.pep: gold
Preliminary Size:1168
Sequenced Size:1104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14792 2002-01-01 Sim4 clustering to Release 2
CG14792 2002-05-18 Blastp of sequenced clone
CG14792 2003-01-01 Sim4 clustering to Release 3
sta 2008-04-29 Release 5.5 accounting
sta 2008-08-15 Release 5.9 accounting
sta 2008-12-18 5.12 accounting

Clone Sequence Records

LD09376.complete Sequence

1104 bp (1104 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118899

> LD09376.complete
CTGCGTCGGAGTGAAAAAACCGAAAAAGTCGGAACGCGTCGCGATACGGA
AAAAAACCGTTTAACGCGAACGCAACACCGATTCTCTGCATGCCAACGTC
GCCAACTTCAACCCGGAAATCGGCCATTTTGTCAAAACTCCCAGCGGCAT
CTAGACGTCCGTAACTCTTTCCACGTTAACATGTCGGGAGGCTTAGATAT
TCTGTCCCTCAAGGAGGACGACATCACCAAGATGTTGGTGGCCACCACCC
ATCTGGGTTCCGAGAACGTCAACTTCCAGATGGAGCAGTACGTGTACAAG
CGCCGCGCTGATGGCGTCAACATCCTCAACCTGGGCAAGACCTGGGAGAA
GCTGCAGCTGGCGGCCCGCGCCATCGTGGCCATCGATAACCCCTCGGACA
TCTTCGTCATCTCGTCGCGTCCGATCGGCCAGCGCGCGGTGCTGAAGTTC
GCCAAGTACACCGACACCACTCCGATCGCCGGCCGCTTCACGCCCGGTGC
CTTCACCAACCAGATCCAGCCCGCTTTCCGCGAGCCGCGTCTGCTGGTGG
TGACCGACCCCAACACCGATCACCAGCCCATCATGGAGGCCAGCTACGTG
AACATCCCCGTGATTGCCTTCACGAACACCGACTCGCCTCTGCGCTACAT
CGACATTGCCATTCCGTGCAACAACAAGTCGGCCCACTCTATCGGTCTGA
TGTGGTGGCTGTTGGCCCGCGAAGTGCTCCGCCTGCGTGGCACCATCTCT
CGCAGCGTCGAGTGGCCCGTAGTCGTCGATCTGTTCTTCTACCGCGATCC
CGAGGAGGCCGAGAAGGAGGAGGCCGCCGCCAAGGAGCTGTTGCCGCCAC
CCAAGATTGAGGAGGCCGTCGACCACCCGGTCGAGGAGACCACCAACTGG
GCCGATGAGGTTGCCGCCGAGACCGTTGGCGGAGTGGAGGACTGGAACGA
GGACACCGTCAAGACCTCCTGGGGTAGCGACGGCCAGTTCTAAGGAATCG
TCCGGGCCACAGATGGCACTACATCAGCACAGCGTTTTGTCAGGAGCCTT
TTCAACGGCATAAATAAACAGCTGTTTATATCTAAAAAAAAAAAAAAAAA
AAAA

LD09376.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
sta.c 1972 sta.c 748..1833 1..1086 5430 100 Plus
sta-RB 1381 sta-RB 157..1242 1..1086 5430 100 Plus
sta-RA 1232 sta-RA 304..1232 157..1085 4645 100 Plus
sta-RA 1232 sta-RA 1..158 1..158 790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1375691..1376374 1083..400 3405 99.9 Minus
chrX 22417052 chrX 1376567..1376809 399..157 1200 99.6 Minus
chrX 22417052 chrX 1377150..1377307 158..1 790 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1481794..1482480 1086..400 3435 100 Minus
X 23542271 X 1482673..1482915 399..157 1215 100 Minus
X 23542271 X 1483256..1483413 158..1 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1489892..1490578 1086..400 3435 100 Minus
X 23527363 X 1490771..1491013 399..157 1215 100 Minus
X 23527363 X 1491354..1491511 158..1 790 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:18:49 has no hits.

LD09376.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:19:49 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1375691..1376374 400..1083 99 <- Minus
chrX 1376567..1376809 157..399 99 <- Minus
chrX 1377152..1377307 1..156 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:42:20 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RD 100..942 150..993 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:16 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RD 100..942 150..993 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:51:21 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..813 181..993 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:29 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RD 100..942 150..993 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:41 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..813 181..993 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:19:12 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..1083 1..1083 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:16 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..1083 1..1083 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:21 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..1083 1..1083 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:29 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..1083 1..1083 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:41 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
sta-RB 1..1083 1..1083 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:49 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
X 1483258..1483413 1..156 100   Minus
X 1482673..1482915 157..399 100 <- Minus
X 1481797..1482480 400..1083 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:49 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
X 1483258..1483413 1..156 100   Minus
X 1482673..1482915 157..399 100 <- Minus
X 1481797..1482480 400..1083 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:49 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
X 1483258..1483413 1..156 100   Minus
X 1482673..1482915 157..399 100 <- Minus
X 1481797..1482480 400..1083 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:21 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1375830..1376513 400..1083 100 <- Minus
arm_X 1376706..1376948 157..399 100 <- Minus
arm_X 1377291..1377446 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:50 Download gff for LD09376.complete
Subject Subject Range Query Range Percent Splice Strand
X 1489895..1490578 400..1083 100 <- Minus
X 1490771..1491013 157..399 100 <- Minus
X 1491356..1491511 1..156 100   Minus

LD09376.hyp Sequence

Translation from 0 to 992

> LD09376.hyp
LRRSEKTEKVGTRRDTEKNRLTRTQHRFSACQRRQLQPGNRPFCQNSQRH
LDVRNSFHVNMSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYK
RRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKF
AKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYV
NIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTIS
RSVEWPVVVDLFFYRDPEEAEKEEAAAKELLPPPKIEEAVDHPVEETTNW
ADEVAAETVGGVEDWNEDTVKTSWGSDGQF*

LD09376.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
sta-PF 270 CG14792-PF 1..270 61..330 1409 100 Plus
sta-PE 270 CG14792-PE 1..270 61..330 1409 100 Plus
sta-PB 270 CG14792-PB 1..270 61..330 1409 100 Plus
sta-PA 270 CG14792-PA 1..270 61..330 1409 100 Plus

LD09376.pep Sequence

Translation from 180 to 992

> LD09376.pep
MSGGLDILSLKEDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILN
LGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIA
GRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNT
DSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVD
LFFYRDPEEAEKEEAAAKELLPPPKIEEAVDHPVEETTNWADEVAAETVG
GVEDWNEDTVKTSWGSDGQF*

LD09376.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21363-PA 270 GF21363-PA 1..270 1..270 1423 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\sta-PA 270 GG12694-PA 1..270 1..270 1426 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17574-PA 272 GH17574-PA 1..272 1..270 1299 93.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
sta-PF 270 CG14792-PF 1..270 1..270 1409 100 Plus
sta-PE 270 CG14792-PE 1..270 1..270 1409 100 Plus
sta-PB 270 CG14792-PB 1..270 1..270 1409 100 Plus
sta-PA 270 CG14792-PA 1..270 1..270 1409 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16040-PA 271 GI16040-PA 1..271 1..270 1381 96.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14373-PA 270 GL14373-PA 1..270 1..270 1399 97 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13249-PA 270 GA13249-PA 1..270 1..270 1399 97 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18969-PA 270 GM18969-PA 1..270 1..270 1432 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\sta-PA 133 GD16420-PA 1..75 1..75 388 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15549-PA 271 GJ15549-PA 1..271 1..270 1381 96.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14587-PA 270 GK14587-PA 1..270 1..270 1389 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\sta-PA 270 GE16523-PA 1..270 1..270 1432 100 Plus