Clone LD09732 Report

Search the DGRC for LD09732

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:97
Well:32
Vector:pBS SK-
Associated Gene/Transcriptcm-RA
Protein status:LD09732.pep: gold
Preliminary Size:1645
Sequenced Size:1477

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3035 2001-11-02 Blastp of sequenced clone
cm 2008-04-29 Release 5.5 accounting
cm 2008-08-15 Release 5.9 accounting
inx7 2008-08-15 Release 5.9 accounting
cm 2008-12-18 5.12 accounting
inx7 2008-12-18 5.12 accounting

Clone Sequence Records

LD09732.complete Sequence

1477 bp (1477 high quality bases) assembled on 2001-11-02

GenBank Submission: AY069388

> LD09732.complete
CTTAAACTAGCAAGCAATTTAGGTCGAATTATGATACACAGTCTGTTTAT
TGTAAACAGCGGCGGCGAGGTCTTCCTGGAAAAGCATTGGCGCTCGGTTG
TCTCGAGATCTGTGTGCGAATACTTCCTTGACGCCCAGCGCGCTGCTCCA
TATGATGTGCCGCCGGTGATAGCCACGCCCCACTACTACCTGATTACAGT
GCAAAGGGACACGGTGTCTTTGGTCGCCGCCTGCAAGCAGGAGGTGCCGC
CGCTCTTTGTCATCGAGTTCCTGCATCGCGTGGTGGACACCTTCCAGGAC
TATTTCGGCGACTGCTCCGAGTCCGTGATCAAGGACAACTATGTGGTCGT
TTACGAGCTGCTGGACGAGATGCTCGATAATGGCTTCCCACTGGCCACCG
AGAGCAACATCCTCAAGGAGCTGATCAAGCCGCCCAATATCCTGCGCACC
ATTGCCAACACGGTGACGGGCAAGAGCAATGTAAGCACTACTTTGCCCTC
GGGTCAGCTGTCGGCGGTTCGCTGGCGCAGAAGCGGCGTGAGGTACACCA
ACAACGAGGCGTACTTCGATGTCATCGAGGAGGTGGACGCTATCATTGAT
AAATCCGGATCCACGGTCTTTGCCGAGATCCAGGGACACATCGACTGCTG
CATTAAGTTATCCGGCATGCCAGATCTGACGTTATCTTTCATGAATCCTC
GCCTCTTCGACGACGTTTCCTTCCATCCTTGCGTGCGCTACAAGCGCTGG
GAGGCGGAGCGCCTGCTCTCCTTTATCCCGCCCGACGGAAACTTCCGCCT
GATGTCATATCACATTAGCTCTCAGTCCGTGGTGGCCATACCCATCTACA
TCAGGCACAACTTTTCGATCAAAACGGGTGAGCAGGGGCGTCTGGACCTC
ACGATTGGCCCGAGGAACACCCTTGGTCGCACCGTTGACAAGGTGAAGCT
GGAGCTGACCATGCCGCGGTGTGTGCTTAATTGCCTATTGACGCCGAATC
AGGGAAAGTATACCTTCGATTCGGTGACCAAGACGCTGTCCTGGGATGTG
GGACGGATCGATGTTTCCAAGTTGCCAAATATTAGGGGATCGGTTTCCAT
TACGCCCGGTACGACCAACATCGATGCCAATCCATCCGTGAATGTCCAGT
TCCAAATCTCGCAGCTGGCCGTCTCTGGGCTAAAGGTAAATCGCCTGGAC
ATGTACGGCGAGAAGTACAAGCCTTTCAAGGGCGTCAAATACCTGACCAA
GGCGGGCAAGTTCCAGGTGCGGATGTAGACAAAATCATCATCCGGATTCC
AATTCCAGCTTTAATTAATAGCTAACGTTAAGTGTATTCCGCTTGTTTTT
TTTTTTTCATTTGATGTTCTAGCCCTCGTCTCTCTCCCTGTGTATCTCAT
TTATGTATCTATATCTCTACCCATAAAATATTAACTTCAAGTGTAAAAAA
AAAAAATGTAAAAAAAAAAAAAAAAAA

LD09732.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
cm-RA 1459 cm-RA 15..1459 1..1444 7185 99.9 Plus
inx7-RB 1690 inx7-RB 1..271 997..1267 1355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6901851..6902305 1094..640 2170 98.5 Minus
chrX 22417052 chrX 6901389..6901743 1445..1092 1725 99.7 Minus
chrX 22417052 chrX 6902597..6902922 479..154 1585 99.1 Minus
chrX 22417052 chrX 6902361..6902520 639..480 770 98.8 Minus
chrX 22417052 chrX 6902977..6903066 154..65 450 100 Minus
chrX 22417052 chrX 6903127..6903191 65..1 325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7009772..7010226 1094..640 2275 100 Minus
X 23542271 X 7009310..7009664 1445..1092 1725 99.7 Minus
X 23542271 X 7010519..7010844 479..154 1630 100 Minus
X 23542271 X 7010283..7010442 639..480 800 100 Minus
X 23542271 X 7010899..7010988 154..65 450 100 Minus
X 23542271 X 7011057..7011121 65..1 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7017870..7018324 1094..640 2275 100 Minus
X 23527363 X 7017408..7017762 1445..1092 1735 99.7 Minus
X 23527363 X 7018617..7018942 479..154 1630 100 Minus
X 23527363 X 7018381..7018540 639..480 800 100 Minus
X 23527363 X 7018997..7019086 154..65 450 100 Minus
X 23527363 X 7019155..7019219 65..1 325 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:32:36 has no hits.

LD09732.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:33:48 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6902978..6903065 66..153 100 <- Minus
chrX 6903127..6903191 1..65 100   Minus
chrX 6901389..6901742 1093..1445 99 <- Minus
chrX 6901853..6902305 640..1092 98 <- Minus
chrX 6902361..6902520 480..639 98 <- Minus
chrX 6902597..6902922 154..479 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:42:51 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 1..1248 31..1278 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:35:35 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 1..1248 31..1278 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:33 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 1..1248 31..1278 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:04:07 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 1..1248 31..1278 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:32:32 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 1..1248 31..1278 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:15:35 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 15..1460 1..1445 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:35:34 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 15..1459 1..1444 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:33 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RB 25..1470 1..1445 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:04:08 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 15..1460 1..1445 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:32:32 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RB 25..1470 1..1445 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:48 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
X 7010283..7010442 480..639 100 <- Minus
X 7009310..7009663 1093..1445 99 <- Minus
X 7009774..7010226 640..1092 100 <- Minus
X 7010519..7010844 154..479 100 <- Minus
X 7010900..7010987 66..153 100 <- Minus
X 7011057..7011121 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:48 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
X 7010283..7010442 480..639 100 <- Minus
X 7009310..7009663 1093..1445 99 <- Minus
X 7009774..7010226 640..1092 100 <- Minus
X 7010519..7010844 154..479 100 <- Minus
X 7010900..7010987 66..153 100 <- Minus
X 7011057..7011121 1..65 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:48 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
X 7010283..7010442 480..639 100 <- Minus
X 7009310..7009663 1093..1445 99 <- Minus
X 7009774..7010226 640..1092 100 <- Minus
X 7010519..7010844 154..479 100 <- Minus
X 7010900..7010987 66..153 100 <- Minus
X 7011057..7011121 1..65 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:33 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6904552..6904877 154..479 100 <- Minus
arm_X 6904933..6905020 66..153 100 <- Minus
arm_X 6905090..6905154 1..65 100   Minus
arm_X 6903343..6903696 1093..1445 99 <- Minus
arm_X 6903807..6904259 640..1092 100 <- Minus
arm_X 6904316..6904475 480..639 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:40:17 Download gff for LD09732.complete
Subject Subject Range Query Range Percent Splice Strand
X 7017408..7017761 1093..1445 99 <- Minus
X 7017872..7018324 640..1092 100 <- Minus
X 7018381..7018540 480..639 100 <- Minus
X 7018617..7018942 154..479 100 <- Minus
X 7018998..7019085 66..153 100 <- Minus
X 7019155..7019219 1..65 100   Minus

LD09732.hyp Sequence

Translation from 0 to 1277

> LD09732.hyp
LKLASNLGRIMIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYFLDAQRAAP
YDVPPVIATPHYYLITVQRDTVSLVAACKQEVPPLFVIEFLHRVVDTFQD
YFGDCSESVIKDNYVVVYELLDEMLDNGFPLATESNILKELIKPPNILRT
IANTVTGKSNVSTTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIID
KSGSTVFAEIQGHIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRYKRW
EAERLLSFIPPDGNFRLMSYHISSQSVVAIPIYIRHNFSIKTGEQGRLDL
TIGPRNTLGRTVDKVKLELTMPRCVLNCLLTPNQGKYTFDSVTKTLSWDV
GRIDVSKLPNIRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVNRLD
MYGEKYKPFKGVKYLTKAGKFQVRM*

LD09732.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
cm-PB 415 CG3035-PB 1..415 11..425 2163 100 Plus
cm-PA 415 CG3035-PA 1..415 11..425 2163 100 Plus
AP-1mu-PA 426 CG9388-PA 5..424 14..424 450 27.4 Plus
AP-2mu-PC 437 CG7057-PC 1..436 11..424 416 27.3 Plus
AP-2mu-PB 437 CG7057-PB 1..436 11..424 416 27.3 Plus

LD09732.pep Sequence

Translation from 30 to 1277

> LD09732.pep
MIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYFLDAQRAAPYDVPPVIATP
HYYLITVQRDTVSLVAACKQEVPPLFVIEFLHRVVDTFQDYFGDCSESVI
KDNYVVVYELLDEMLDNGFPLATESNILKELIKPPNILRTIANTVTGKSN
VSTTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEI
QGHIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRYKRWEAERLLSFIP
PDGNFRLMSYHISSQSVVAIPIYIRHNFSIKTGEQGRLDLTIGPRNTLGR
TVDKVKLELTMPRCVLNCLLTPNQGKYTFDSVTKTLSWDVGRIDVSKLPN
IRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVNRLDMYGEKYKPFK
GVKYLTKAGKFQVRM*

LD09732.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20328-PA 415 GF20328-PA 1..415 1..415 2180 97.8 Plus
Dana\GF16536-PA 426 GF16536-PA 5..424 4..414 467 28.3 Plus
Dana\GF23377-PA 437 GF23377-PA 1..436 1..414 433 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17643-PA 415 GG17643-PA 1..415 1..415 2205 99.3 Plus
Dere\GG17361-PA 426 GG17361-PA 5..424 4..414 467 28.3 Plus
Dere\AP-50-PA 437 GG11137-PA 1..436 1..414 433 28.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24272-PA 415 GH24272-PA 1..415 1..415 2173 97.1 Plus
Dgri\AP-47-PA 426 GH19303-PA 5..424 4..414 464 28.1 Plus
Dgri\GH22222-PA 437 GH22222-PA 1..436 1..414 433 28.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
cm-PB 415 CG3035-PB 1..415 1..415 2163 100 Plus
cm-PA 415 CG3035-PA 1..415 1..415 2163 100 Plus
AP-1mu-PA 426 CG9388-PA 5..424 4..414 450 27.4 Plus
AP-2mu-PC 437 CG7057-PC 1..436 1..414 416 27.3 Plus
AP-2mu-PB 437 CG7057-PB 1..436 1..414 416 27.3 Plus
AP-2mu-PA 437 CG7057-PA 1..436 1..414 416 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21579-PA 415 GI21579-PA 1..415 1..415 2164 96.6 Plus
Dmoj\GI23520-PA 426 GI23520-PA 5..424 4..414 464 28.3 Plus
Dmoj\GI21976-PA 437 GI21976-PA 1..436 1..414 433 28.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26809-PA 436 GL26809-PA 1..436 1..415 1898 83.7 Plus
Dper\GL21499-PA 426 GL21499-PA 5..424 4..414 466 28.5 Plus
Dper\GL24218-PA 437 GL24218-PA 1..436 1..414 433 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15778-PA 415 GA15778-PA 1..415 1..415 2186 98.1 Plus
Dpse\GA21750-PA 426 GA21750-PA 5..424 4..414 466 28.5 Plus
Dpse\GA20066-PA 437 GA20066-PA 1..436 1..414 433 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17484-PA 415 GM17484-PA 1..415 1..415 2217 99.8 Plus
Dsec\GM26246-PA 426 GM26246-PA 5..424 4..414 467 28.3 Plus
Dsec\GM26435-PA 437 GM26435-PA 1..436 1..414 433 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16169-PA 416 GD16169-PA 1..401 1..401 2115 98.3 Plus
Dsim\GD20786-PA 426 GD20786-PA 5..424 4..414 467 28.3 Plus
Dsim\AP-50-PA 437 GD20952-PA 1..436 1..414 433 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15801-PA 415 GJ15801-PA 1..415 1..415 2137 95.4 Plus
Dvir\GJ10271-PA 426 GJ10271-PA 5..424 4..414 464 28.3 Plus
Dvir\GJ14336-PA 437 GJ14336-PA 1..436 1..414 435 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25293-PA 415 GK25293-PA 1..415 1..415 2186 98.1 Plus
Dwil\GK11256-PA 426 GK11256-PA 5..424 4..414 465 28.3 Plus
Dwil\GK11695-PA 437 GK11695-PA 1..436 1..414 433 28.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17549-PA 415 GE17549-PA 1..415 1..415 2218 99.8 Plus
Dyak\GE24766-PA 426 GE24766-PA 5..424 4..414 467 28.3 Plus
Dyak\AP-50-PA 437 GE10302-PA 1..436 1..414 433 28.2 Plus