Clone LD09733 Report

Search the DGRC for LD09733

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:97
Well:33
Vector:pBS SK-
Associated Gene/Transcripthng2-RA
Protein status:LD09733.pep: gold
Preliminary Size:1386
Sequenced Size:1213

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8359 2001-01-01 Release 2 assignment
CG8359 2002-06-10 Blastp of sequenced clone
CG8359 2003-01-01 Sim4 clustering to Release 3
CG8359 2008-04-29 Release 5.5 accounting
CG8359 2008-08-15 Release 5.9 accounting
CG8359 2008-12-18 5.12 accounting

Clone Sequence Records

LD09733.complete Sequence

1213 bp (1213 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121643

> LD09733.complete
ATCCAATCCAACCCTTAAATAAACAATAAATAATGGGCAATCATAAAGTT
CTTCGATCGGCAGGAAGCAATTTGCGCTATTCGATGTACGAGTTCATTGA
CGCGGTACACAAACGTTCTATTATATGGGAACGAAGCCACCCAAACTTCC
ATAACCGCGAACTCAGAGATGAGGCCTGGCAGCAAATTGGCCACGAGCTT
TGCTCGAATTTTGACGACTCCAGCGAGCCGGAGAAGCAGGAAATAGTTAA
AACACTGCTCAAACGTTGGAAAAACACGAGGGACAGCTACCTACGGGTCA
ACCGACTACGTCAAAGTGGCGAGGAGGTGGCCAGAGCTTCCTACATCTAC
GAAAAGGAACTGAGTTTCCTGCTGAACGTGAAAGCAGAGTCGGAGGACGA
TGTAGAATCCTTGAAGGAGCAACCCAAGCCCCAGGCCAAACGGAAGCGAG
TGAGCACTGCCGCACAGAGATCTGCAAAGACTCCACGAAAGAGAAACTCC
GACCAAGAATCGAATATTGAGCCTGCCATCCGCAATCCAGCCATACCAAG
CAACATAAATACGGTTCTGGGAGATCTGGGCTGCGCCAAGGAGGACACCG
CCACTCCGGAAATCGCATATATTCCACAGTTACCATCAGATCCACCCTGC
AGTACAAATACCGCCTACTTGTCCGCCGATCCTGATCAGGCCTTCTTCGA
CACCATTAAGCCTCACATGCAGCAGATGTGCGCCGATCGCAAGCTTGACT
TTCAGATCGAGGTCCTGAAAATCCTACGAAACTTCAAGCCGAATTGAATA
TTCACTACAGAAGTCAAATCATTTACAAATGCATTTACAAGAAGGGCAAA
ATTCGTTTAACAGCAAGTTAACATAAGCAATAAGAATACATTTAATCGTT
ATCGTAAATCGTCTAATCTTTAGGGCGCGAAATTTAAATAATGAACTGTA
ATTTGTAATTTAATATACAAACAATAATATTCACAAACCAGGGGTTAAAC
TTTAATGCAACCAATGATTCAATTATTTTTTTTAGTTCTTAATAATGCGT
CAAATAGTTTTCTCATAGTAACTTCTGTGTTTTGCGCAATGTATATATTA
TACGCTTACTTTTGTAATTTTTGATAATAATACAATAGTTGTAGAGTTAT
TTAAGACAATGAAAAAAACATTAAAAACAACATTAAATAATGTATAAAAA
AAAAAAAAAAAAA

LD09733.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8359-RA 1237 CG8359-RA 43..1237 1..1195 5975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4632580..4633530 245..1195 4740 99.9 Plus
chr3R 27901430 chr3R 4632283..4632528 1..246 1230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8806631..8807587 245..1201 4785 100 Plus
3R 32079331 3R 8806334..8806579 1..246 1230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8547462..8548418 245..1201 4785 100 Plus
3R 31820162 3R 8547165..8547410 1..246 1230 100 Plus
Blast to na_te.dros performed 2019-03-15 20:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 5026..5069 1147..1190 130 77.3 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1425..1490 1157..1094 118 66.7 Minus

LD09733.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:19:59 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4632283..4632528 1..246 100 -> Plus
chr3R 4632582..4633530 247..1195 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:42:52 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 1..765 33..797 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:26:43 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 1..765 33..797 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:51:35 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 1..765 33..797 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:17:09 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 1..765 33..797 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:59 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
hng2-RA 1..765 33..797 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:55:09 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 1..1194 2..1195 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:26:43 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 11..1205 1..1195 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:35 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 13..1207 1..1195 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:17:09 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
CG8359-RA 1..1194 2..1195 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:59 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
hng2-RA 13..1207 1..1195 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:59 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8806334..8806579 1..246 100 -> Plus
3R 8806633..8807581 247..1195 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:59 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8806334..8806579 1..246 100 -> Plus
3R 8806633..8807581 247..1195 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:59 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8806334..8806579 1..246 100 -> Plus
3R 8806633..8807581 247..1195 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:35 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4632056..4632301 1..246 100 -> Plus
arm_3R 4632355..4633303 247..1195 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:50:31 Download gff for LD09733.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8547165..8547410 1..246 100 -> Plus
3R 8547464..8548412 247..1195 100   Plus

LD09733.pep Sequence

Translation from 32 to 796

> LD09733.pep
MGNHKVLRSAGSNLRYSMYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQ
QIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDSYLRVNRLRQSGEEVA
RASYIYEKELSFLLNVKAESEDDVESLKEQPKPQAKRKRVSTAAQRSAKT
PRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAYIPQL
PSDPPCSTNTAYLSADPDQAFFDTIKPHMQQMCADRKLDFQIEVLKILRN
FKPN*

LD09733.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18193-PA 248 GF18193-PA 1..248 1..254 868 67 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13214-PA 254 GG13214-PA 1..254 1..254 1257 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18253-PA 282 GH18253-PA 1..265 1..251 666 53.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
hng2-PA 254 CG8359-PA 1..254 1..254 1329 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23652-PA 253 GI23652-PA 1..253 1..254 728 57.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12487-PA 260 GL12487-PA 1..260 1..254 820 61 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21016-PA 260 GA21016-PA 1..260 1..254 807 60.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23767-PA 254 GM23767-PA 1..254 1..254 1289 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18578-PA 254 GD18578-PA 1..254 1..254 1309 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23496-PA 252 GJ23496-PA 1..252 1..254 697 58 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11258-PA 250 GK11258-PA 1..250 1..254 696 55.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25911-PA 254 GE25911-PA 1..254 1..254 1286 93.7 Plus

LD09733.hyp Sequence

Translation from 32 to 796

> LD09733.hyp
MGNHKVLRSAGSNLRYSMYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQ
QIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDSYLRVNRLRQSGEEVA
RASYIYEKELSFLLNVKAESEDDVESLKEQPKPQAKRKRVSTAAQRSAKT
PRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAYIPQL
PSDPPCSTNTAYLSADPDQAFFDTIKPHMQQMCADRKLDFQIEVLKILRN
FKPN*

LD09733.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
hng2-PA 254 CG8359-PA 1..254 1..254 1329 100 Plus