Clone LD09786 Report

Search the DGRC for LD09786

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:97
Well:86
Vector:pBS SK-
Associated Gene/TranscriptLhr-RA
Protein status:LD09786.pep: gold
Preliminary Size:1341
Sequenced Size:1188

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18468 2001-01-01 Release 2 assignment
CG18468 2001-10-10 Blastp of sequenced clone
CG18468 2003-01-01 Sim4 clustering to Release 3
Lhr 2008-04-29 Release 5.5 accounting
Lhr 2008-08-15 Release 5.9 accounting
Lhr 2008-12-18 5.12 accounting

Clone Sequence Records

LD09786.complete Sequence

1188 bp (1188 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061112

> LD09786.complete
CTATTAGTTAGCAAACACAAATTAAAACTCGGATTCTAAAAACATAGATT
TTATTAAAGAAATTACCGTTAAGTGGTATATTAAAACATACGGATGAATT
AGTACACAAATGTGTTGTAGAACGTTGGAGAAACACAGTGCGAAAAATAT
TAAAATGAGTACCGACAGCGCCGAGGAAACGGTGATCCATTCCACTGTTC
CCCATTTGGAGATTAACATATCAAACACCAACATCAGCGGCCAGATTGTT
TTAAACGACTTGCTGCTCATGGAGATGCTCGCCCGGTATCCCTTCCTTAT
CATCCCGCAGGTGGAGCCCAAAATGGACGTTGACTACGACTCCTGGGGTT
GGGATCAGCTGGCCAAGTCCTTTAACCAAAGCTACGAGCACGTTGAGCTG
AGTACTCCGTTCTCCGTAAGTGAACTGAAGCTGCGTTGGGTGAAGCTGCG
CCCGCTGGTCAGAGCCTTGGCCGGTTCCAAAGGGCAAATCCCTGAACCTC
TGTGGCGGGTGATGCACGATGTGCACATTCGCATGCAAGCCCCGAATCCG
GCGGATGTGCCGAAAACCAAGTGTCAGGAGTTTCTTCTCAGTCAGTTGCC
TTTCGTGAAATCTATGGCGCAAGCGGAACGCCGGCATTTAGAAGTGGAGG
TCCTCGCCCTCATCCTGGAGCAAGAGCGCCAAGAGAAAGCTACTCGAAAG
CTGGGTCCTAAGGACCTGGAGACGGTTCAGAGCGAATACGACGAATTTCT
TAAAGCGATACGGGTGAAAGAGCTCCCAGCAGACAATTTACTCAGTCCGG
CCATGGACAGATTCGGCATTAGCCCACACAAAATAAGACCCAATGTCGCA
AGTGCCAATAAAAGAATCAGATATAATAATGCTTGCAAAGGATCAAATGA
TGTCAAAATCAAAATAGAAACAGCTATTGAACCTAAAATTAAAGATACAA
CAAAATGTGACGAACGACCGATAGAAACACCACGCTTCGTTCCTCTTAAA
AGCGCGAAATACTACATTAAAAGGTGTCGCATCCGGCTGAAGCGAGTGGA
AATTGATGATTATTTACCCTTAGCTAGAATACGGCGCTCAAGGCGGCCTA
CGCTGAGAACATGACTTTCTTTCGTATAAAATGCACATAAGTTTATTAAA
AAATACATTACTATAAATTAAAAAAAAAAAAAAAAAAA

LD09786.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Lhr-RA 1173 Lhr-RA 1..1170 1..1170 5850 100 Plus
EDTP-RA 3317 EDTP-RA 3200..3317 1170..1053 590 100 Minus
EDTP.a 3202 EDTP.a 3092..3202 1170..1060 555 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13318115..13319283 1..1169 5830 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:55:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17431051..17432220 1..1170 5850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17432250..17433419 1..1170 5850 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:53:06 has no hits.

LD09786.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:53:48 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13318115..13319283 1..1169 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:42:54 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1005 110..1114 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:49:45 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1005 110..1114 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:53:59 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1005 110..1114 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:18:33 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1005 110..1114 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:50:53 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1005 110..1114 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:34:09 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1169 1..1169 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:49:45 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1169 1..1169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:53:59 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 20..1188 1..1169 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:18:33 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 1..1169 1..1169 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:50:53 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
Lhr-RA 20..1188 1..1169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:48 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17431051..17432219 1..1169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:48 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17431051..17432219 1..1169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:48 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17431051..17432219 1..1169 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:53:59 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13318556..13319724 1..1169 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:55:28 Download gff for LD09786.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17432250..17433418 1..1169 100   Plus

LD09786.hyp Sequence

Translation from 109 to 1113

> LD09786.hyp
MCCRTLEKHSAKNIKMSTDSAEETVIHSTVPHLEINISNTNISGQIVLND
LLLMEMLARYPFLIIPQVEPKMDVDYDSWGWDQLAKSFNQSYEHVELSTP
FSVSELKLRWVKLRPLVRALAGSKGQIPEPLWRVMHDVHIRMQAPNPADV
PKTKCQEFLLSQLPFVKSMAQAERRHLEVEVLALILEQERQEKATRKLGP
KDLETVQSEYDEFLKAIRVKELPADNLLSPAMDRFGISPHKIRPNVASAN
KRIRYNNACKGSNDVKIKIETAIEPKIKDTTKCDERPIETPRFVPLKSAK
YYIKRCRIRLKRVEIDDYLPLARIRRSRRPTLRT*

LD09786.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Lhr-PA 334 CG18468-PA 1..334 1..334 1727 100 Plus

LD09786.pep Sequence

Translation from 109 to 1113

> LD09786.pep
MCCRTLEKHSAKNIKMSTDSAEETVIHSTVPHLEINISNTNISGQIVLND
LLLMEMLARYPFLIIPQVEPKMDVDYDSWGWDQLAKSFNQSYEHVELSTP
FSVSELKLRWVKLRPLVRALAGSKGQIPEPLWRVMHDVHIRMQAPNPADV
PKTKCQEFLLSQLPFVKSMAQAERRHLEVEVLALILEQERQEKATRKLGP
KDLETVQSEYDEFLKAIRVKELPADNLLSPAMDRFGISPHKIRPNVASAN
KRIRYNNACKGSNDVKIKIETAIEPKIKDTTKCDERPIETPRFVPLKSAK
YYIKRCRIRLKRVEIDDYLPLARIRRSRRPTLRT*

LD09786.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Lhr-PA 321 GF13120-PA 17..316 35..329 525 40.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Lhr-PA 325 GG20678-PA 1..325 16..334 1244 72.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Lhr-PA 334 CG18468-PA 1..334 1..334 1727 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18576-PA 414 GI18576-PA 1..230 16..250 394 36.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11424-PA 429 GL11424-PA 24..291 28..289 475 38.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Lhr-PA 414 GA14945-PA 7..271 15..272 461 39.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21773-PA 237 GM21773-PA 1..223 16..222 919 78.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Lhr-PA 335 GD11266-PA 1..335 16..334 1393 80 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Lhr-PA 325 GJ20370-PA 9..321 32..328 558 39.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22897-PA 354 GK22897-PA 9..354 32..329 533 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Lhr-PA 325 GE11661-PA 1..325 16..334 1224 71.5 Plus