Clone LD09836 Report

Search the DGRC for LD09836

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:98
Well:36
Vector:pBS SK-
Associated Gene/TranscriptCG12746-RE
Protein status:LD09836.pep: validated full length
Preliminary Size:1487
Sequenced Size:1234

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12746 2001-01-01 Release 2 assignment
CG12746 2001-11-09 Blastp of sequenced clone
CG12746 2008-04-29 Release 5.5 accounting
CG12746 2008-08-15 Release 5.9 accounting
CG12746 2008-12-18 5.12 accounting

Clone Sequence Records

LD09836.complete Sequence

1234 bp (1234 high quality bases) assembled on 2001-11-09

GenBank Submission: AY069390

> LD09836.complete
TGAAAGGGGCTGGCTTCGCAGTTTGTTTTACGATGCTGTTGCGAGATTAG
AGAAAGTTTATAAAAAGCCCTGCCATTAGCATTCAGCAGCATTAGCAATC
GGGAAGCAGTCAAGTTGAAACCACGTCGGGATTAACGCCACCAGACTAAC
AACGAGTGGATGCCCCAAGTGCAAACAGTTCCAAAGTCAACTCAAATATA
CCCAAATCCCAGGAGATTGCATCGGATCGGGTGATAATGCCCGATAGTTG
TACGGCGGACCTACGAAGTCGCCGCCGCGAAAATCCAATCGACCGCAACG
GCAATATTGGCGGCACAGGCAAGGAGCAGGCGACAAGCACCAGGCCTAAG
CTGACAACCGAATATACCCAACGGACTAACGAAATGACTGCGAGCAAGGA
AGGTCAAGAATCCAGGCGAACCCTCAGCGACAGTTCCGCAGAGGACGTCA
GGAATACAGGATCGAGGACCAGGACCAACGACGACGAAATGTGGCGCAAT
GAACTTGCTATGAACACGGACAGCAGCTCCGTTCAGCCAGAAAAGCGAGA
GGAACGAAGCCACAGAACAGGAAACTCTAATGCGAAGCTCAGCGATGCCG
TAGATGTTGTTCTTCGCGTTCTCCTCGTCATTACCTTCTTCAAGTTGGAG
ACGATGACAGCATTCAAACGGGAAATCCACGAGGAAGAGCTGTGGCTATA
CAAGAACCCAAGGCGACCGGACATTGTCAGGGGCGGGGAGCTGCTCTTCT
GGGTGATAGTGGCTCCCTTTCTGGTCACTATCGCCTTCTACTGGTACACA
AGAGACAGGCGGCTCTGCATCGCTGTGATACCTCTGTTTATCGCACTGCT
GGTTGCAGTTAGTCGCACCTGCGACTACCACCACCACTGGCAGGATGTGA
CCATCGGCGGGCTGATTGGCCTGTTTGCAGGCTATATAAGCTACACACAA
TACTATCCCTCCATCTTCTGCCCTGATGCCGGCATACCACTGGTCAGGTG
GCCCAGCAGAGAGGGAAGCCAGTACCAGCGACTGTCTGGAAAGGACGACA
ATGGCAGTCGTGGTCCCCACCATCTCGATGGTGGGGATGCGGTGCGGAGA
CCTCTGCTCGCTGACAAGGAGGAGTCCAAATGGTACTAAAAGCTTTACGT
AATATTATTGTGAGTGTTGCTTTCCCGTTTAAGGTTTTTAAACATATTAG
ACAATTTCTGATTTAAAAAAAAAAAAAAAAAAAA

LD09836.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12746-RE 1613 CG12746-RE 1..811 2..812 4055 100 Plus
CG12746.b 1273 CG12746.b 28..511 329..812 2420 100 Plus
CG12746.a 1270 CG12746.a 26..508 330..812 2415 100 Plus
CG12746-RE 1613 CG12746-RE 1143..1554 808..1219 2060 100 Plus
CG12746.b 1273 CG12746.b 843..1254 808..1219 2060 100 Plus
CG12746.a 1270 CG12746.a 840..1251 808..1219 2060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1392688..1393094 808..1214 2035 100 Plus
chr3R 27901430 chr3R 1390784..1391113 1..330 1650 100 Plus
chr3R 27901430 chr3R 1391745..1392057 328..640 1565 100 Plus
chr3R 27901430 chr3R 1392126..1392297 641..812 860 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5567029..5567440 808..1219 2060 100 Plus
3R 32079331 3R 5565125..5565454 1..330 1650 100 Plus
3R 32079331 3R 5566086..5566398 328..640 1565 100 Plus
3R 32079331 3R 5566467..5566638 641..812 860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5307860..5308271 808..1219 2060 100 Plus
3R 31820162 3R 5305956..5306285 1..330 1650 100 Plus
3R 31820162 3R 5306917..5307229 328..640 1565 100 Plus
3R 31820162 3R 5307298..5307469 641..812 860 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:32:39 has no hits.

LD09836.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:33:50 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1390784..1391112 1..329 100 -> Plus
chr3R 1391747..1392057 330..640 100 -> Plus
chr3R 1392126..1392293 641..808 100 -> Plus
chr3R 1392689..1393094 809..1214 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:42:59 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..431 384..813 99 <- Plus
CG12746-RE 767..1092 814..1139 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:30:00 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..431 384..813 99 <- Plus
CG12746-RE 767..1092 814..1139 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:38 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RB 1..431 384..813 99 <- Plus
CG12746-RB 767..1092 814..1139 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:57:35 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..431 384..813 99 <- Plus
CG12746-RE 767..1092 814..1139 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:32:33 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RB 1..431 384..813 99 <- Plus
CG12746-RB 767..1092 814..1139 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:07:45 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..773 42..813 99 <- Plus
CG12746-RE 1109..1509 814..1214 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:30:00 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1109..1509 814..1214 100   Plus
CG12746-RE 1..773 42..813 99 <- Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:38 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..773 42..813 99 <- Plus
CG12746-RE 1109..1509 814..1214 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:57:35 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..773 42..813 99 <- Plus
CG12746-RE 1109..1509 814..1214 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:32:33 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
CG12746-RE 1..773 42..813 99 <- Plus
CG12746-RE 1109..1509 814..1214 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:50 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5566467..5566634 641..808 100 -> Plus
3R 5565125..5565453 1..329 100 -> Plus
3R 5566088..5566398 330..640 100 -> Plus
3R 5567030..5567435 809..1214 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:50 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5566467..5566634 641..808 100 -> Plus
3R 5565125..5565453 1..329 100 -> Plus
3R 5566088..5566398 330..640 100 -> Plus
3R 5567030..5567435 809..1214 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:33:50 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5566467..5566634 641..808 100 -> Plus
3R 5565125..5565453 1..329 100 -> Plus
3R 5566088..5566398 330..640 100 -> Plus
3R 5567030..5567435 809..1214 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:38 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1390847..1391175 1..329 100 -> Plus
arm_3R 1391810..1392120 330..640 100 -> Plus
arm_3R 1392189..1392356 641..808 100 -> Plus
arm_3R 1392752..1393157 809..1214 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:33:56 Download gff for LD09836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5305956..5306284 1..329 100 -> Plus
3R 5306919..5307229 330..640 100 -> Plus
3R 5307298..5307465 641..808 100 -> Plus
3R 5307861..5308266 809..1214 100   Plus

LD09836.pep Sequence

Translation from 236 to 1138

> LD09836.pep
MPDSCTADLRSRRRENPIDRNGNIGGTGKEQATSTRPKLTTEYTQRTNEM
TASKEGQESRRTLSDSSAEDVRNTGSRTRTNDDEMWRNELAMNTDSSSVQ
PEKREERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREIHEE
ELWLYKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRLCIAVIPL
FIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCPDAGI
PLVRWPSREGSQYQRLSGKDDNGSRGPHHLDGGDAVRRPLLADKEESKWY
*

LD09836.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11605-PA 356 GF11605-PA 1..158 50..199 509 63 Plus
Dana\GF11605-PA 356 GF11605-PA 252..356 192..300 416 67.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12892-PA 409 GG12892-PA 1..221 1..210 823 77.5 Plus
Dere\GG12892-PA 409 GG12892-PA 304..409 192..300 479 84.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22403-PA 342 GH22403-PA 247..342 192..300 331 56.9 Plus
Dgri\GH22403-PA 342 GH22403-PA 6..135 58..192 281 48.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12746-PE 363 CG12746-PE 1..143 50..192 738 100 Plus
CG12746-PD 363 CG12746-PD 1..143 50..192 738 100 Plus
CG12746-PB 363 CG12746-PB 1..143 50..192 738 100 Plus
CG12746-PE 363 CG12746-PE 255..363 192..300 601 100 Plus
CG12746-PD 363 CG12746-PD 255..363 192..300 601 100 Plus
CG12746-PB 363 CG12746-PB 255..363 192..300 601 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24490-PA 340 GI24490-PA 246..316 192..262 302 73.2 Plus
Dmoj\GI24490-PA 340 GI24490-PA 34..134 85..192 274 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21673-PA 359 GL21673-PA 1..146 50..192 440 59.9 Plus
Dper\GL21673-PA 359 GL21673-PA 258..359 192..300 389 65.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11785-PA 359 GA11785-PA 1..146 50..192 443 60.5 Plus
Dpse\GA11785-PA 359 GA11785-PA 258..359 192..300 394 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10814-PA 407 GM10814-PA 1..221 1..210 863 82 Plus
Dsec\GM10814-PA 407 GM10814-PA 304..407 192..300 528 89.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19793-PA 407 GD19793-PA 1..172 1..170 705 87.8 Plus
Dsim\GD19793-PA 407 GD19793-PA 301..407 192..300 536 91.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24555-PA 327 GJ24555-PA 1..135 50..192 358 49 Plus
Dvir\GJ24555-PA 327 GJ24555-PA 247..326 192..299 257 50.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14299-PA 357 GK14299-PA 11..177 54..210 375 50 Plus
Dwil\GK14299-PA 357 GK14299-PA 258..356 192..292 292 53.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10136-PA 404 GE10136-PA 1..216 1..210 791 72.1 Plus
Dyak\GE10136-PA 404 GE10136-PA 299..404 192..300 456 81.7 Plus

LD09836.hyp Sequence

Translation from 236 to 1138

> LD09836.hyp
MPDSCTADLRSRRRENPIDRNGNIGGTGKEQATSTRPKLTTEYTQRTNEM
TASKEGQESRRTLSDSSAEDVRNTGSRTRTNDDEMWRNELAMNTDSSSVQ
PEKREERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREIHEE
ELWLYKNPRRPDIVRGGELLFWVIVAPFLVTIAFYWYTRDRRLCIAVIPL
FIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSIFCPDAGI
PLVRWPSREGSQYQRLSGKDDNGSRGPHHLDGGDAVRRPLLADKEESKWY
*

LD09836.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG12746-PE 363 CG12746-PE 1..143 50..192 738 100 Plus
CG12746-PD 363 CG12746-PD 1..143 50..192 738 100 Plus
CG12746-PB 363 CG12746-PB 1..143 50..192 738 100 Plus
CG12746-PE 363 CG12746-PE 255..363 192..300 601 100 Plus
CG12746-PD 363 CG12746-PD 255..363 192..300 601 100 Plus
CG12746-PB 363 CG12746-PB 255..363 192..300 601 100 Plus