Clone LD09945 Report

Search the DGRC for LD09945

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:99
Well:45
Vector:pBS SK-
Associated Gene/TranscriptCG3587-RA
Protein status:LD09945.pep: gold
Preliminary Size:1261
Sequenced Size:1084

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3587 2001-01-01 Release 2 assignment
CG3587 2001-10-10 Blastp of sequenced clone
CG3587 2003-01-01 Sim4 clustering to Release 3
CG3587 2008-04-29 Release 5.5 accounting
CG3587 2008-08-15 Release 5.9 accounting
CG3587 2008-12-18 5.12 accounting

Clone Sequence Records

LD09945.complete Sequence

1084 bp (1084 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061115

> LD09945.complete
CGACACCTACTTTGTTTATTTATTGTTATTAATTAGGAAGCATGCCCCTC
GTGGTGATTACGGGCCTGCCAGCCAGCGGAAAGAGCACACGTGCCCGCCA
GCTACGGGATCATTTCGTGGAGCGCGGCAGGAAGGTGCATCTAATCAGCG
AAAACGAGGCAGTGCCCAAGGCGGGTTTTGGAAAGAATTCCCATACAGGT
GATTCGCAGAAGGAGAAGGTGGTACGTAGCGATCTTAAGTCGGAAGCCTC
GCGTCACCTTAACCAGGAGGATCTGGTCATCTTGGACGCCGGGAACTACA
TCAAAGGCTACCGCTACGAATTGTACTGCATGTCCAAGGTGTCAAGGACC
ACCCAGTGCACTGTGTTTACCTGCATACCCCAGGAGGAGGCGTGGACCTT
TAATAGCCAAAGAACGGCGCCGGATGAACTGCCTGGCGACAGTGAAAGAG
TTCAGCCGGTGGACAACTCGGATGTTCCCTACACCAGAGAGACTTTTGAT
GCTCTGTGCCAGCGCTACGAGGAGCCGCAGAGCAACAACCGTTGGGACAG
TCCGCTGGTGGTAGTCTTGCCCAAGGACACGCTCGACATGGAGGCCATCT
ACAAGGCCTTGTACGAGTCCCAGCCACTGCCACCCAACCAGAGTACTTAT
AATGCACCGCTGGGAACAACCAACTACCTGTTCGAACTGGACAAAATCGT
GCAGGCGATCATCAAGGAGATCCTCGGCGCCGTCAAGATCAAGGCCTTCG
GCCAGCTGCGCATCCCAGGGAGCAGAAATCCCGTGAAGGTCGCCACTTCG
ATGAATGCCCTCCAGCTGAACCGCCTGCGCCAGAAGTTCATCACGAGCAC
GTGCCACGCCAGCCAGACGTCACCCACTCCGCTGGAGCAGGTGCCGCACT
TGTTCGTGCAGTTCATCAATGCCAACACGATCGGCTGCTAGCACTGTGAT
TGCGACAAGACAAATGCTAAAATAAAGTTCTTACCTCGGGCAGCAGGATA
ATGTTTTTGGGCTGATGTTGACACAATTTAATGTGGAAATCAAATAAAAT
ATGTAGCTTAAATACTAAAAAAAAAAAAAAAAAA

LD09945.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG3587-RA 1288 CG3587-RA 155..1222 1..1068 5340 100 Plus
CG3587.a 1130 CG3587.a 96..1127 37..1068 5160 100 Plus
CG3587.b 1142 CG3587.b 101..1128 41..1068 5140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1834970..1835382 654..1066 2065 100 Plus
chrX 22417052 chrX 1834554..1834903 305..654 1750 100 Plus
chrX 22417052 chrX 1834195..1834498 4..307 1520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:56:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1941124..1941538 654..1068 2075 100 Plus
X 23542271 X 1940708..1941057 305..654 1750 100 Plus
X 23542271 X 1940346..1940652 1..307 1535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1949222..1949636 654..1068 2075 100 Plus
X 23527363 X 1948806..1949155 305..654 1750 100 Plus
X 23527363 X 1948444..1948750 1..307 1535 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:08:44 has no hits.

LD09945.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:09:38 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1834192..1834497 1..306 99 -> Plus
chrX 1834556..1834902 307..653 100 -> Plus
chrX 1834970..1835382 654..1066 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:43:11 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 1..900 42..941 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:48:09 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 1..900 42..941 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:30 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 1..900 42..941 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:16:52 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 1..900 42..941 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:01:21 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 1..900 42..941 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:32:06 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 111..1176 1..1066 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:48:09 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 111..1176 1..1066 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:30 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 111..1176 1..1066 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:16:52 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 111..1176 1..1066 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:21 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
CG3587-RA 40..1105 1..1066 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:38 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
X 1940346..1940651 1..306 100 -> Plus
X 1940710..1941056 307..653 100 -> Plus
X 1941124..1941536 654..1066 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:38 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
X 1940346..1940651 1..306 100 -> Plus
X 1940710..1941056 307..653 100 -> Plus
X 1941124..1941536 654..1066 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:09:38 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
X 1940346..1940651 1..306 100 -> Plus
X 1940710..1941056 307..653 100 -> Plus
X 1941124..1941536 654..1066 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:30 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1834379..1834684 1..306 100 -> Plus
arm_X 1834743..1835089 307..653 100 -> Plus
arm_X 1835157..1835569 654..1066 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:53:49 Download gff for LD09945.complete
Subject Subject Range Query Range Percent Splice Strand
X 1948444..1948749 1..306 100 -> Plus
X 1948808..1949154 307..653 100 -> Plus
X 1949222..1949634 654..1066 100   Plus

LD09945.pep Sequence

Translation from 41 to 940

> LD09945.pep
MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNS
HTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKV
SRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRE
TFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQ
STYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQLRIPGSRNPVKV
ATSMNALQLNRLRQKFITSTCHASQTSPTPLEQVPHLFVQFINANTIGC*

LD09945.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22188-PA 300 GF22188-PA 1..300 1..299 1362 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12894-PA 299 GG12894-PA 1..299 1..299 1543 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17893-PA 300 GH17893-PA 1..300 1..299 1200 73.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3587-PA 299 CG3587-PA 1..299 1..299 1559 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21683-PA 298 GI21683-PA 1..298 1..299 1152 69.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15252-PA 299 GL15252-PA 1..299 1..299 1252 76.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17539-PA 299 GA17539-PA 1..299 1..299 1252 76.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19183-PA 299 GM19183-PA 1..299 1..299 1569 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16579-PA 299 GD16579-PA 1..299 1..299 1575 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15862-PA 299 GJ15862-PA 1..299 1..299 1238 74.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25181-PA 293 GK25181-PA 1..293 1..299 1220 74.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16225-PA 299 GE16225-PA 1..299 1..299 1528 94.3 Plus

LD09945.hyp Sequence

Translation from 41 to 940

> LD09945.hyp
MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNS
HTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKV
SRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRE
TFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQ
STYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQLRIPGSRNPVKV
ATSMNALQLNRLRQKFITSTCHASQTSPTPLEQVPHLFVQFINANTIGC*

LD09945.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG3587-PA 299 CG3587-PA 1..299 1..299 1559 100 Plus